BLASTX nr result
ID: Papaver30_contig00058044
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver30_contig00058044 (520 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002532555.1| conserved hypothetical protein [Ricinus comm... 67 7e-09 ref|XP_007020843.1| Uncharacterized protein TCM_030892 [Theobrom... 56 9e-06 >ref|XP_002532555.1| conserved hypothetical protein [Ricinus communis] gi|223527710|gb|EEF29816.1| conserved hypothetical protein [Ricinus communis] Length = 690 Score = 66.6 bits (161), Expect = 7e-09 Identities = 26/53 (49%), Positives = 36/53 (67%) Frame = -1 Query: 520 MENKIYFPRLHNEGILFYSLDSGKYHSLGSEHYGTDYCNSKDNLRCSWIEPNW 362 MENKI+FPR + E I+FYSLD+ K+HS + ++ S++ LRC W EP W Sbjct: 637 MENKIFFPRFYGENIVFYSLDTNKFHSFDRQKIPIEFYISREQLRCGWFEPRW 689 >ref|XP_007020843.1| Uncharacterized protein TCM_030892 [Theobroma cacao] gi|508720471|gb|EOY12368.1| Uncharacterized protein TCM_030892 [Theobroma cacao] Length = 741 Score = 56.2 bits (134), Expect = 9e-06 Identities = 22/53 (41%), Positives = 35/53 (66%) Frame = -1 Query: 520 MENKIYFPRLHNEGILFYSLDSGKYHSLGSEHYGTDYCNSKDNLRCSWIEPNW 362 MENKIYFP++ + I++Y L +GKY + GS+ T++ N+ + L WI+ W Sbjct: 688 MENKIYFPKIKGKEIVYYCLRTGKYRTFGSKQAATNFYNTTEYLHSCWIQQRW 740