BLASTX nr result
ID: Papaver30_contig00057043
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver30_contig00057043 (624 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002304586.1| hypothetical protein POPTR_0003s14900g [Popu... 47 3e-06 >ref|XP_002304586.1| hypothetical protein POPTR_0003s14900g [Populus trichocarpa] gi|222842018|gb|EEE79565.1| hypothetical protein POPTR_0003s14900g [Populus trichocarpa] Length = 390 Score = 47.0 bits (110), Expect(2) = 3e-06 Identities = 25/48 (52%), Positives = 33/48 (68%), Gaps = 1/48 (2%) Frame = -1 Query: 558 LSIGDVVKVENEENFRSAIHLQASNYEDGIGYVEIVN-QKRNNLMLKR 418 LS+GDVVKV +E F S + L +S+YEDG+ YVE +N NL +KR Sbjct: 129 LSVGDVVKVNKDEYFPSDLLLLSSSYEDGVCYVETMNLDGETNLKVKR 176 Score = 31.2 bits (69), Expect(2) = 3e-06 Identities = 14/31 (45%), Positives = 20/31 (64%) Frame = -3 Query: 421 KVSLRVTLGSDKDIEFIKLEAAINCEDQRPA 329 K L VTL ++D +F +L+A I CED P+ Sbjct: 175 KRCLEVTLDLNEDAKFSELKATIRCEDHNPS 205