BLASTX nr result
ID: Papaver30_contig00055423
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver30_contig00055423 (462 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN78447.1| hypothetical protein VITISV_026810 [Vitis vinifera] 58 2e-06 >emb|CAN78447.1| hypothetical protein VITISV_026810 [Vitis vinifera] Length = 1171 Score = 58.2 bits (139), Expect = 2e-06 Identities = 29/67 (43%), Positives = 41/67 (61%), Gaps = 1/67 (1%) Frame = -1 Query: 198 ICEKLSGNY-FLL*KTQFLPYLQGYGLEGFVNGFIKCPPAQTENSSSIPKFISWTRTDKL 22 I KL G++ +L K QFL L+G+ L GF++G CPP T + S P ++ W + D Sbjct: 21 ISVKLDGSHNYLAWKMQFLNLLRGHDLMGFIDGTEACPPKHTASGSLNPAYVVWQKKDVC 80 Query: 21 LLGWILS 1 LLGWIL+ Sbjct: 81 LLGWILA 87