BLASTX nr result
ID: Papaver30_contig00054976
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver30_contig00054976 (543 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|WP_043967345.1| coiled-coil protein [Anoxybacillus thermarum... 59 1e-06 >ref|WP_043967345.1| coiled-coil protein [Anoxybacillus thermarum] gi|756576218|gb|KIQ93759.1| chromosome segregation protein [Anoxybacillus thermarum] Length = 230 Score = 59.3 bits (142), Expect = 1e-06 Identities = 30/106 (28%), Positives = 64/106 (60%) Frame = -2 Query: 320 SREEIKSPFYNLPTFQQALQRKVSELEAKNSTLQDQIKRKNEEKQALDQRISKLETENST 141 +RE+++S L +A+++KV LE + S+L++Q++ +E+ QA+D ++ L+ + Sbjct: 16 TREKVES----LEKRVEAVEKKVESLEKEVSSLREQVQALDEKVQAIDGKVQALDEKVQV 71 Query: 140 LQHNVKMSKEKQQIFDDKVSKLEAKIYTMQDEINRNKEEQQSMDKR 3 L V+ EK Q+ D+KV L+ K+ + +++ + Q++D+R Sbjct: 72 LDEKVQALDEKVQVLDEKVQALDEKVQVLDEKVQTLDGKVQALDER 117