BLASTX nr result
ID: Papaver30_contig00054831
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver30_contig00054831 (405 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007225448.1| hypothetical protein PRUPE_ppa000347mg [Prun... 56 9e-06 >ref|XP_007225448.1| hypothetical protein PRUPE_ppa000347mg [Prunus persica] gi|462422384|gb|EMJ26647.1| hypothetical protein PRUPE_ppa000347mg [Prunus persica] Length = 1260 Score = 56.2 bits (134), Expect = 9e-06 Identities = 26/55 (47%), Positives = 41/55 (74%), Gaps = 1/55 (1%) Frame = +1 Query: 1 PRAMRSTTAN-TDPFKEKNSEQAEKSFQNREVGLSTPRNTAWQTRDSEEKENHGI 162 PRAMRS +N ++PF+E+N+++ ++S N+E G+ TPR+ Q R S+EKEN G+ Sbjct: 1206 PRAMRSAASNGSNPFRERNADKPDQSGVNKEGGIPTPRSPLRQNRTSDEKENRGL 1260