BLASTX nr result
ID: Papaver30_contig00054492
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver30_contig00054492 (533 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010030658.1| PREDICTED: B3 domain-containing protein Os01... 57 5e-06 gb|KCW55285.1| hypothetical protein EUGRSUZ_I01211 [Eucalyptus g... 57 5e-06 >ref|XP_010030658.1| PREDICTED: B3 domain-containing protein Os01g0723500-like, partial [Eucalyptus grandis] Length = 323 Score = 57.0 bits (136), Expect = 5e-06 Identities = 31/73 (42%), Positives = 43/73 (58%) Frame = -1 Query: 248 LQTIPLKFVREHLLAEVTNPDGVLDVLLQNEEGLRWEVVVRPNGIDRYAFFKGWKNFATD 69 L +P KF +EH L TN ++L++ EG W+V NG R+ F +GW+ F D Sbjct: 239 LLPVPSKFAKEHFLWRRTN------IVLRDAEGQTWKVAHHCNG-KRHYFSRGWRAFLYD 291 Query: 68 NKLKIGDCVIFEL 30 N+LKIGD IFE+ Sbjct: 292 NELKIGDVCIFEV 304 >gb|KCW55285.1| hypothetical protein EUGRSUZ_I01211 [Eucalyptus grandis] Length = 347 Score = 57.0 bits (136), Expect = 5e-06 Identities = 31/73 (42%), Positives = 43/73 (58%) Frame = -1 Query: 248 LQTIPLKFVREHLLAEVTNPDGVLDVLLQNEEGLRWEVVVRPNGIDRYAFFKGWKNFATD 69 L +P KF +EH L TN ++L++ EG W+V NG R+ F +GW+ F D Sbjct: 263 LLPVPSKFAKEHFLWRRTN------IVLRDAEGQTWKVAHHCNG-KRHYFSRGWRAFLYD 315 Query: 68 NKLKIGDCVIFEL 30 N+LKIGD IFE+ Sbjct: 316 NELKIGDVCIFEV 328