BLASTX nr result
ID: Papaver30_contig00054399
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver30_contig00054399 (446 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010241042.1| PREDICTED: pentatricopeptide repeat-containi... 38 3e-08 >ref|XP_010241042.1| PREDICTED: pentatricopeptide repeat-containing protein At3g13160, mitochondrial-like [Nelumbo nucifera] Length = 380 Score = 37.7 bits (86), Expect(3) = 3e-08 Identities = 15/19 (78%), Positives = 17/19 (89%) Frame = +3 Query: 360 FFGDGRFSDGEMIWARMKK 416 F+GD RFSDGE IWARM+K Sbjct: 211 FYGDNRFSDGEEIWARMEK 229 Score = 34.7 bits (78), Expect(3) = 3e-08 Identities = 30/85 (35%), Positives = 41/85 (48%), Gaps = 21/85 (24%) Frame = +2 Query: 173 TVRSFK-----CLDSENFEE----FVRLNSSLN------------QAFCKIASLDSSLSM 289 TV+SF C DS NF++ F L S L+ +A C SLDS+LS Sbjct: 129 TVKSFNALLSACADSRNFDKVDQIFRELPSRLSITPDLFSYNIMVRALCDRGSLDSALSF 188 Query: 290 LNASE*N*VNP*YWVAFSMLLKGFF 364 L+ E N V+P + F+ LL F+ Sbjct: 189 LDEMEKNGVSP-NLITFNTLLNAFY 212 Score = 31.2 bits (69), Expect(3) = 3e-08 Identities = 20/48 (41%), Positives = 26/48 (54%), Gaps = 11/48 (22%) Frame = +1 Query: 61 VKEIRKIQKKDNITTKDDFAVRTTPP-----------KMFDELPELKC 171 V+EI + QKK +K+ FAVR +MFD+LPELKC Sbjct: 79 VEEILEHQKKYADISKEGFAVRLISLYGQSGMSEHACRMFDQLPELKC 126