BLASTX nr result
ID: Papaver30_contig00054270
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver30_contig00054270 (418 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010032253.1| PREDICTED: macrophage erythroblast attacher ... 58 2e-06 ref|XP_009393358.1| PREDICTED: macrophage erythroblast attacher-... 58 2e-06 ref|XP_009393357.1| PREDICTED: macrophage erythroblast attacher-... 58 2e-06 gb|KCW51663.1| hypothetical protein EUGRSUZ_J01144 [Eucalyptus g... 58 2e-06 gb|KCW51662.1| hypothetical protein EUGRSUZ_J01144 [Eucalyptus g... 58 2e-06 ref|XP_011018776.1| PREDICTED: macrophage erythroblast attacher ... 57 5e-06 ref|XP_008812008.1| PREDICTED: macrophage erythroblast attacher-... 56 9e-06 >ref|XP_010032253.1| PREDICTED: macrophage erythroblast attacher [Eucalyptus grandis] Length = 413 Score = 58.2 bits (139), Expect = 2e-06 Identities = 28/35 (80%), Positives = 31/35 (88%) Frame = +3 Query: 81 IDVFCDAKKVIDALQSREVPLALAWCTENKSRSKK 185 IDVF +AKKVIDALQ++EV ALAWCTENKSR KK Sbjct: 175 IDVFLEAKKVIDALQNKEVGPALAWCTENKSRLKK 209 >ref|XP_009393358.1| PREDICTED: macrophage erythroblast attacher-like isoform X2 [Musa acuminata subsp. malaccensis] Length = 420 Score = 58.2 bits (139), Expect = 2e-06 Identities = 27/35 (77%), Positives = 31/35 (88%) Frame = +3 Query: 81 IDVFCDAKKVIDALQSREVPLALAWCTENKSRSKK 185 IDVF +AKKVID+LQ++EV LALAWC ENKSR KK Sbjct: 182 IDVFLEAKKVIDSLQNKEVALALAWCAENKSRLKK 216 >ref|XP_009393357.1| PREDICTED: macrophage erythroblast attacher-like isoform X1 [Musa acuminata subsp. malaccensis] Length = 423 Score = 58.2 bits (139), Expect = 2e-06 Identities = 27/35 (77%), Positives = 31/35 (88%) Frame = +3 Query: 81 IDVFCDAKKVIDALQSREVPLALAWCTENKSRSKK 185 IDVF +AKKVID+LQ++EV LALAWC ENKSR KK Sbjct: 185 IDVFLEAKKVIDSLQNKEVALALAWCAENKSRLKK 219 >gb|KCW51663.1| hypothetical protein EUGRSUZ_J01144 [Eucalyptus grandis] Length = 348 Score = 58.2 bits (139), Expect = 2e-06 Identities = 28/35 (80%), Positives = 31/35 (88%) Frame = +3 Query: 81 IDVFCDAKKVIDALQSREVPLALAWCTENKSRSKK 185 IDVF +AKKVIDALQ++EV ALAWCTENKSR KK Sbjct: 242 IDVFLEAKKVIDALQNKEVGPALAWCTENKSRLKK 276 >gb|KCW51662.1| hypothetical protein EUGRSUZ_J01144 [Eucalyptus grandis] Length = 480 Score = 58.2 bits (139), Expect = 2e-06 Identities = 28/35 (80%), Positives = 31/35 (88%) Frame = +3 Query: 81 IDVFCDAKKVIDALQSREVPLALAWCTENKSRSKK 185 IDVF +AKKVIDALQ++EV ALAWCTENKSR KK Sbjct: 242 IDVFLEAKKVIDALQNKEVGPALAWCTENKSRLKK 276 >ref|XP_011018776.1| PREDICTED: macrophage erythroblast attacher [Populus euphratica] Length = 412 Score = 57.0 bits (136), Expect = 5e-06 Identities = 33/56 (58%), Positives = 38/56 (67%) Frame = +3 Query: 18 GLKLLFSSPVLWLCYETMCSKIDVFCDAKKVIDALQSREVPLALAWCTENKSRSKK 185 GLKL SS +L L IDVF ++K+VIDALQ REV ALAWC +NKSR KK Sbjct: 159 GLKLAESSDMLDLV------DIDVFLESKRVIDALQKREVAPALAWCADNKSRLKK 208 >ref|XP_008812008.1| PREDICTED: macrophage erythroblast attacher-like [Phoenix dactylifera] Length = 344 Score = 56.2 bits (134), Expect = 9e-06 Identities = 26/35 (74%), Positives = 30/35 (85%) Frame = +3 Query: 81 IDVFCDAKKVIDALQSREVPLALAWCTENKSRSKK 185 ID+F DAKKVID+LQ++EV ALAWC ENKSR KK Sbjct: 106 IDIFLDAKKVIDSLQNKEVGPALAWCAENKSRLKK 140