BLASTX nr result
ID: Papaver30_contig00053974
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver30_contig00053974 (517 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007039140.1| Transcription factor IIIC, subunit 5, putati... 58 2e-06 ref|XP_007039139.1| Transcription factor IIIC, subunit 5, putati... 58 2e-06 ref|XP_007039138.1| General transcription factor 3C polypeptide ... 58 2e-06 ref|XP_011463418.1| PREDICTED: general transcription factor 3C p... 57 5e-06 ref|XP_004297697.1| PREDICTED: general transcription factor 3C p... 57 5e-06 ref|XP_011465770.1| PREDICTED: general transcription factor 3C p... 57 7e-06 ref|XP_004287180.2| PREDICTED: general transcription factor 3C p... 57 7e-06 >ref|XP_007039140.1| Transcription factor IIIC, subunit 5, putative isoform 3 [Theobroma cacao] gi|508776385|gb|EOY23641.1| Transcription factor IIIC, subunit 5, putative isoform 3 [Theobroma cacao] Length = 579 Score = 58.2 bits (139), Expect = 2e-06 Identities = 29/44 (65%), Positives = 33/44 (75%) Frame = +1 Query: 163 SEKLKEF*RKRGDLCPFRVFPWKCQTALQLFKLDDGYFQQEIKK 294 + KLK K DLC FRVFP+KCQT LQLF+LDD Y QQEI+K Sbjct: 356 ANKLKH---KWEDLCSFRVFPYKCQTFLQLFELDDDYIQQEIRK 396 >ref|XP_007039139.1| Transcription factor IIIC, subunit 5, putative isoform 2 [Theobroma cacao] gi|508776384|gb|EOY23640.1| Transcription factor IIIC, subunit 5, putative isoform 2 [Theobroma cacao] Length = 582 Score = 58.2 bits (139), Expect = 2e-06 Identities = 29/44 (65%), Positives = 33/44 (75%) Frame = +1 Query: 163 SEKLKEF*RKRGDLCPFRVFPWKCQTALQLFKLDDGYFQQEIKK 294 + KLK K DLC FRVFP+KCQT LQLF+LDD Y QQEI+K Sbjct: 356 ANKLKH---KWEDLCSFRVFPYKCQTFLQLFELDDDYIQQEIRK 396 >ref|XP_007039138.1| General transcription factor 3C polypeptide 5, putative isoform 1 [Theobroma cacao] gi|508776383|gb|EOY23639.1| General transcription factor 3C polypeptide 5, putative isoform 1 [Theobroma cacao] Length = 630 Score = 58.2 bits (139), Expect = 2e-06 Identities = 29/44 (65%), Positives = 33/44 (75%) Frame = +1 Query: 163 SEKLKEF*RKRGDLCPFRVFPWKCQTALQLFKLDDGYFQQEIKK 294 + KLK K DLC FRVFP+KCQT LQLF+LDD Y QQEI+K Sbjct: 364 ANKLKH---KWEDLCSFRVFPYKCQTFLQLFELDDDYIQQEIRK 404 >ref|XP_011463418.1| PREDICTED: general transcription factor 3C polypeptide 5-like isoform X2 [Fragaria vesca subsp. vesca] Length = 550 Score = 57.0 bits (136), Expect = 5e-06 Identities = 24/36 (66%), Positives = 29/36 (80%) Frame = +1 Query: 190 KRGDLCPFRVFPWKCQTALQLFKLDDGYFQQEIKKA 297 K DLC FRVFP+KC T LQLF+LDD Y Q++I+KA Sbjct: 341 KWSDLCAFRVFPYKCHTTLQLFELDDNYIQEQIRKA 376 >ref|XP_004297697.1| PREDICTED: general transcription factor 3C polypeptide 5-like isoform X1 [Fragaria vesca subsp. vesca] Length = 553 Score = 57.0 bits (136), Expect = 5e-06 Identities = 24/36 (66%), Positives = 29/36 (80%) Frame = +1 Query: 190 KRGDLCPFRVFPWKCQTALQLFKLDDGYFQQEIKKA 297 K DLC FRVFP+KC T LQLF+LDD Y Q++I+KA Sbjct: 341 KWSDLCAFRVFPYKCHTTLQLFELDDNYIQEQIRKA 376 >ref|XP_011465770.1| PREDICTED: general transcription factor 3C polypeptide 5-like isoform X2 [Fragaria vesca subsp. vesca] Length = 547 Score = 56.6 bits (135), Expect = 7e-06 Identities = 24/36 (66%), Positives = 29/36 (80%) Frame = +1 Query: 190 KRGDLCPFRVFPWKCQTALQLFKLDDGYFQQEIKKA 297 K DLC FRVFP+KC T LQLF+LDD Y Q++I+KA Sbjct: 337 KWSDLCAFRVFPYKCHTTLQLFELDDDYIQEQIRKA 372 >ref|XP_004287180.2| PREDICTED: general transcription factor 3C polypeptide 5-like isoform X1 [Fragaria vesca subsp. vesca] gi|764506490|ref|XP_011465739.1| PREDICTED: general transcription factor 3C polypeptide 5-like isoform X1 [Fragaria vesca subsp. vesca] Length = 550 Score = 56.6 bits (135), Expect = 7e-06 Identities = 24/36 (66%), Positives = 29/36 (80%) Frame = +1 Query: 190 KRGDLCPFRVFPWKCQTALQLFKLDDGYFQQEIKKA 297 K DLC FRVFP+KC T LQLF+LDD Y Q++I+KA Sbjct: 337 KWSDLCAFRVFPYKCHTTLQLFELDDDYIQEQIRKA 372