BLASTX nr result
ID: Papaver30_contig00053721
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver30_contig00053721 (1533 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010062970.1| PREDICTED: pentatricopeptide repeat-containi... 45 1e-08 gb|KCW70130.1| hypothetical protein EUGRSUZ_F03427 [Eucalyptus g... 45 1e-08 gb|KCW70131.1| hypothetical protein EUGRSUZ_F03427 [Eucalyptus g... 45 1e-08 ref|XP_009591130.1| PREDICTED: pentatricopeptide repeat-containi... 49 1e-07 ref|XP_009769116.1| PREDICTED: pentatricopeptide repeat-containi... 49 2e-07 ref|XP_002522838.1| pentatricopeptide repeat-containing protein,... 42 9e-07 gb|KCW70132.1| hypothetical protein EUGRSUZ_F03427 [Eucalyptus g... 44 9e-06 >ref|XP_010062970.1| PREDICTED: pentatricopeptide repeat-containing protein At4g04790, mitochondrial-like [Eucalyptus grandis] Length = 878 Score = 45.4 bits (106), Expect(2) = 1e-08 Identities = 28/66 (42%), Positives = 36/66 (54%) Frame = -3 Query: 766 EKLLHFIYSYANSIPVLVVEDTMSEFEKLHEKFHVPVPAYL*YGEPFKY*CALLF*VELS 587 E + FI+ Y +P LVVED +S+F LHEK V P+ YG Y CA L E+ Sbjct: 385 EHVTKFIFDYVAYMPNLVVEDVISKFRSLHEKLKVK-PSSTSYGSLINYCCASL---EVK 440 Query: 586 RKLDLV 569 LD+V Sbjct: 441 TALDIV 446 Score = 43.5 bits (101), Expect(2) = 1e-08 Identities = 22/45 (48%), Positives = 30/45 (66%), Gaps = 2/45 (4%) Frame = -2 Query: 563 VYLRICQHILKPSS--FRRMINLLVRVEDFDGAYNMLSDMKEMGV 435 +Y + +H L P++ FR MINL VR+ DFD AYNML D + M + Sbjct: 480 IYSMMHRHNLIPNTDIFRSMINLSVRMRDFDSAYNMLEDAQRMNL 524 >gb|KCW70130.1| hypothetical protein EUGRSUZ_F03427 [Eucalyptus grandis] Length = 774 Score = 45.4 bits (106), Expect(2) = 1e-08 Identities = 28/66 (42%), Positives = 36/66 (54%) Frame = -3 Query: 766 EKLLHFIYSYANSIPVLVVEDTMSEFEKLHEKFHVPVPAYL*YGEPFKY*CALLF*VELS 587 E + FI+ Y +P LVVED +S+F LHEK V P+ YG Y CA L E+ Sbjct: 281 EHVTKFIFDYVAYMPNLVVEDVISKFRSLHEKLKVK-PSSTSYGSLINYCCASL---EVK 336 Query: 586 RKLDLV 569 LD+V Sbjct: 337 TALDIV 342 Score = 43.5 bits (101), Expect(2) = 1e-08 Identities = 22/45 (48%), Positives = 30/45 (66%), Gaps = 2/45 (4%) Frame = -2 Query: 563 VYLRICQHILKPSS--FRRMINLLVRVEDFDGAYNMLSDMKEMGV 435 +Y + +H L P++ FR MINL VR+ DFD AYNML D + M + Sbjct: 376 IYSMMHRHNLIPNTDIFRSMINLSVRMRDFDSAYNMLEDAQRMNL 420 >gb|KCW70131.1| hypothetical protein EUGRSUZ_F03427 [Eucalyptus grandis] Length = 700 Score = 45.4 bits (106), Expect(2) = 1e-08 Identities = 28/66 (42%), Positives = 36/66 (54%) Frame = -3 Query: 766 EKLLHFIYSYANSIPVLVVEDTMSEFEKLHEKFHVPVPAYL*YGEPFKY*CALLF*VELS 587 E + FI+ Y +P LVVED +S+F LHEK V P+ YG Y CA L E+ Sbjct: 207 EHVTKFIFDYVAYMPNLVVEDVISKFRSLHEKLKVK-PSSTSYGSLINYCCASL---EVK 262 Query: 586 RKLDLV 569 LD+V Sbjct: 263 TALDIV 268 Score = 43.5 bits (101), Expect(2) = 1e-08 Identities = 22/45 (48%), Positives = 30/45 (66%), Gaps = 2/45 (4%) Frame = -2 Query: 563 VYLRICQHILKPSS--FRRMINLLVRVEDFDGAYNMLSDMKEMGV 435 +Y + +H L P++ FR MINL VR+ DFD AYNML D + M + Sbjct: 302 IYSMMHRHNLIPNTDIFRSMINLSVRMRDFDSAYNMLEDAQRMNL 346 >ref|XP_009591130.1| PREDICTED: pentatricopeptide repeat-containing protein At4g04790, mitochondrial-like isoform X1 [Nicotiana tomentosiformis] Length = 858 Score = 48.5 bits (114), Expect(2) = 1e-07 Identities = 23/46 (50%), Positives = 32/46 (69%), Gaps = 2/46 (4%) Frame = -2 Query: 563 VYLRICQHILKPSS--FRRMINLLVRVEDFDGAYNMLSDMKEMGVM 432 +Y + +H LKP S FR MIN+ VR +DF+GAY M+ D+K+ VM Sbjct: 460 IYSMLLRHGLKPDSETFRIMINMTVRAKDFEGAYGMIEDLKKFDVM 505 Score = 36.6 bits (83), Expect(2) = 1e-07 Identities = 24/66 (36%), Positives = 35/66 (53%) Frame = -3 Query: 766 EKLLHFIYSYANSIPVLVVEDTMSEFEKLHEKFHVPVPAYL*YGEPFKY*CALLF*VELS 587 E + FIY+Y S+P +ED M EF+ LH + + P Y + Y C LF V ++ Sbjct: 365 ENISKFIYNYTTSMPNFALEDVMLEFKNLHAELEL-TPTSSQYQKLIMY-CCELFKVHVA 422 Query: 586 RKLDLV 569 LD+V Sbjct: 423 --LDMV 426 >ref|XP_009769116.1| PREDICTED: pentatricopeptide repeat-containing protein At4g04790, mitochondrial-like [Nicotiana sylvestris] Length = 858 Score = 48.5 bits (114), Expect(2) = 2e-07 Identities = 23/46 (50%), Positives = 32/46 (69%), Gaps = 2/46 (4%) Frame = -2 Query: 563 VYLRICQHILKPSS--FRRMINLLVRVEDFDGAYNMLSDMKEMGVM 432 +Y + +H LKP S FR MIN+ VR +DF+GAY M+ D+K+ VM Sbjct: 460 IYSMLLRHGLKPDSETFRIMINMTVRAKDFEGAYGMIEDLKKFDVM 505 Score = 36.2 bits (82), Expect(2) = 2e-07 Identities = 24/66 (36%), Positives = 35/66 (53%) Frame = -3 Query: 766 EKLLHFIYSYANSIPVLVVEDTMSEFEKLHEKFHVPVPAYL*YGEPFKY*CALLF*VELS 587 E + FIY+Y S+P +ED M EF+ LH + + P Y + Y C LF V ++ Sbjct: 365 ENISKFIYNYTTSMPNFALEDVMLEFKNLHAEVEL-TPTSSQYQKLIMY-CCELFKVHVA 422 Query: 586 RKLDLV 569 LD+V Sbjct: 423 --LDMV 426 >ref|XP_002522838.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223537922|gb|EEF39536.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 867 Score = 42.0 bits (97), Expect(2) = 9e-07 Identities = 20/42 (47%), Positives = 30/42 (71%), Gaps = 2/42 (4%) Frame = -2 Query: 563 VYLRICQHILKPSS--FRRMINLLVRVEDFDGAYNMLSDMKE 444 +Y IC H L P++ FR MI L V+++DF GA++ML D+K+ Sbjct: 484 IYSLICHHNLTPNNETFRSMIKLRVKMKDFCGAHDMLDDLKK 525 Score = 40.4 bits (93), Expect(2) = 9e-07 Identities = 25/68 (36%), Positives = 38/68 (55%) Frame = -3 Query: 772 ETEKLLHFIYSYANSIPVLVVEDTMSEFEKLHEKFHVPVPAYL*YGEPFKY*CALLF*VE 593 +TE + I+SYA S+P L VED + +F+ LH +P P+ Y + Y C LL + Sbjct: 387 DTENISTLIFSYATSVPNLAVEDAILKFKNLHVMLEMP-PSSKSYEKLIIYSCDLL---K 442 Query: 592 LSRKLDLV 569 + LD+V Sbjct: 443 VHAALDIV 450 >gb|KCW70132.1| hypothetical protein EUGRSUZ_F03427 [Eucalyptus grandis] Length = 479 Score = 43.5 bits (101), Expect(2) = 9e-06 Identities = 22/45 (48%), Positives = 30/45 (66%), Gaps = 2/45 (4%) Frame = -2 Query: 563 VYLRICQHILKPSS--FRRMINLLVRVEDFDGAYNMLSDMKEMGV 435 +Y + +H L P++ FR MINL VR+ DFD AYNML D + M + Sbjct: 81 IYSMMHRHNLIPNTDIFRSMINLSVRMRDFDSAYNMLEDAQRMNL 125 Score = 35.4 bits (80), Expect(2) = 9e-06 Identities = 22/51 (43%), Positives = 29/51 (56%) Frame = -3 Query: 721 VLVVEDTMSEFEKLHEKFHVPVPAYL*YGEPFKY*CALLF*VELSRKLDLV 569 +L+VED +S+F LHEK V P+ YG Y CA L E+ LD+V Sbjct: 1 MLLVEDVISKFRSLHEKLKVK-PSSTSYGSLINYCCASL---EVKTALDIV 47