BLASTX nr result
ID: Papaver30_contig00052854
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver30_contig00052854 (483 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011459655.1| PREDICTED: zinc finger BED domain-containing... 59 1e-06 ref|XP_010089760.1| Putative AC transposase [Morus notabilis] gi... 58 3e-06 ref|XP_011457610.1| PREDICTED: uncharacterized protein LOC105349... 58 3e-06 ref|XP_006384292.1| hypothetical protein POPTR_0004s11480g [Popu... 58 3e-06 ref|XP_006384497.1| hypothetical protein POPTR_0004s15890g [Popu... 57 4e-06 gb|KMS98900.1| hypothetical protein BVRB_3g067910 [Beta vulgaris... 57 5e-06 ref|XP_010693749.1| PREDICTED: zinc finger BED domain-containing... 57 5e-06 ref|XP_010675028.1| PREDICTED: zinc finger BED domain-containing... 57 5e-06 ref|XP_012850967.1| PREDICTED: uncharacterized protein LOC105970... 56 9e-06 >ref|XP_011459655.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 2-like [Fragaria vesca subsp. vesca] Length = 828 Score = 58.9 bits (141), Expect = 1e-06 Identities = 25/35 (71%), Positives = 33/35 (94%) Frame = -2 Query: 482 ESAFSTGKRILDPFRSSLKPKTLEALILLQNWLRT 378 ES+FSTGKR++DP+RSSL PK++EALI LQNWL++ Sbjct: 691 ESSFSTGKRVIDPYRSSLTPKSVEALICLQNWLKS 725 >ref|XP_010089760.1| Putative AC transposase [Morus notabilis] gi|587848058|gb|EXB38352.1| Putative AC transposase [Morus notabilis] Length = 485 Score = 57.8 bits (138), Expect = 3e-06 Identities = 27/38 (71%), Positives = 31/38 (81%) Frame = -2 Query: 482 ESAFSTGKRILDPFRSSLKPKTLEALILLQNWLRTPID 369 ESAFSTG RILDPFRSSL PK +EAL+ QNWL++ D Sbjct: 229 ESAFSTGGRILDPFRSSLNPKMVEALVCTQNWLKSTHD 266 >ref|XP_011457610.1| PREDICTED: uncharacterized protein LOC105349496 [Fragaria vesca subsp. vesca] Length = 300 Score = 57.8 bits (138), Expect = 3e-06 Identities = 25/35 (71%), Positives = 30/35 (85%) Frame = -2 Query: 482 ESAFSTGKRILDPFRSSLKPKTLEALILLQNWLRT 378 ES FST KR++DPFRSSL P+T+EALI QNWLR+ Sbjct: 111 ESCFSTSKRVIDPFRSSLSPRTVEALICFQNWLRS 145 >ref|XP_006384292.1| hypothetical protein POPTR_0004s11480g [Populus trichocarpa] gi|550340841|gb|ERP62089.1| hypothetical protein POPTR_0004s11480g [Populus trichocarpa] Length = 620 Score = 57.8 bits (138), Expect = 3e-06 Identities = 30/45 (66%), Positives = 35/45 (77%), Gaps = 1/45 (2%) Frame = -2 Query: 482 ESAFSTGKRILDPFRSSLKPKTLEALILLQNWL-RTPIDMDSSTL 351 ESAFSTG RILD FRSSL P T++ALI QNWL PI +D++TL Sbjct: 560 ESAFSTGGRILDQFRSSLSPATVQALICCQNWLHHDPIPVDNTTL 604 >ref|XP_006384497.1| hypothetical protein POPTR_0004s15890g [Populus trichocarpa] gi|550341124|gb|ERP62294.1| hypothetical protein POPTR_0004s15890g [Populus trichocarpa] Length = 520 Score = 57.4 bits (137), Expect = 4e-06 Identities = 30/45 (66%), Positives = 35/45 (77%), Gaps = 1/45 (2%) Frame = -2 Query: 482 ESAFSTGKRILDPFRSSLKPKTLEALILLQNWL-RTPIDMDSSTL 351 ESAFSTG RILD FRSSL P T++ALI QNWL PI +D++TL Sbjct: 460 ESAFSTGGRILDQFRSSLSPATVQALICCQNWLHHGPITVDNTTL 504 >gb|KMS98900.1| hypothetical protein BVRB_3g067910 [Beta vulgaris subsp. vulgaris] Length = 715 Score = 57.0 bits (136), Expect = 5e-06 Identities = 27/41 (65%), Positives = 35/41 (85%), Gaps = 1/41 (2%) Frame = -2 Query: 482 ESAFSTGKRILDPFRSSLKPKTLEALILLQNWLR-TPIDMD 363 ESAFSTG R+LDPFRSSL PK +EAL+ Q+WLR +P+D++ Sbjct: 649 ESAFSTGGRVLDPFRSSLTPKIVEALVCGQDWLRASPVDVE 689 >ref|XP_010693749.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 2-like [Beta vulgaris subsp. vulgaris] Length = 754 Score = 57.0 bits (136), Expect = 5e-06 Identities = 27/41 (65%), Positives = 35/41 (85%), Gaps = 1/41 (2%) Frame = -2 Query: 482 ESAFSTGKRILDPFRSSLKPKTLEALILLQNWLR-TPIDMD 363 ESAFSTG R+LDPFRSSL PK +EAL+ Q+WLR +P+D++ Sbjct: 688 ESAFSTGGRVLDPFRSSLTPKIVEALVCGQDWLRASPVDVE 728 >ref|XP_010675028.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 2-like [Beta vulgaris subsp. vulgaris] Length = 712 Score = 57.0 bits (136), Expect = 5e-06 Identities = 27/41 (65%), Positives = 35/41 (85%), Gaps = 1/41 (2%) Frame = -2 Query: 482 ESAFSTGKRILDPFRSSLKPKTLEALILLQNWLR-TPIDMD 363 ESAFSTG R+LDPFRSSL PK +EAL+ Q+WLR +P+D++ Sbjct: 646 ESAFSTGGRVLDPFRSSLTPKIVEALVCGQDWLRASPVDVE 686 >ref|XP_012850967.1| PREDICTED: uncharacterized protein LOC105970681 [Erythranthe guttatus] Length = 1098 Score = 56.2 bits (134), Expect = 9e-06 Identities = 27/43 (62%), Positives = 34/43 (79%), Gaps = 1/43 (2%) Frame = -2 Query: 482 ESAFSTGKRILDPFRSSLKPKTLEALILLQNWLR-TPIDMDSS 357 ESAFS G R++DPFRSSL PKT EALI Q+W+R +P D++ S Sbjct: 662 ESAFSVGGRVIDPFRSSLSPKTAEALICAQDWIRSSPTDIELS 704