BLASTX nr result
ID: Papaver30_contig00051560
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver30_contig00051560 (425 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_013454715.1| F-box and associated interaction domain prot... 58 3e-06 ref|XP_012460771.1| PREDICTED: F-box protein CPR30-like [Gossypi... 56 9e-06 >ref|XP_013454715.1| F-box and associated interaction domain protein [Medicago truncatula] gi|657386410|gb|KEH28746.1| F-box and associated interaction domain protein [Medicago truncatula] Length = 419 Score = 57.8 bits (138), Expect = 3e-06 Identities = 29/62 (46%), Positives = 37/62 (59%), Gaps = 6/62 (9%) Frame = +2 Query: 227 RDAYKHGNDSPSDLTL------NILTRLPADSVIQCKQVCKTWKDLLCQPSFPQAHLLHQ 388 R + H N SP +TL IL+RLP S+IQ K VCK+WK L+ PSF + HL H Sbjct: 4 RHLHSHSNPSPPSVTLPDEVLTEILSRLPVKSLIQMKSVCKSWKTLISHPSFIKIHLNHS 63 Query: 389 LN 394 L+ Sbjct: 64 LS 65 >ref|XP_012460771.1| PREDICTED: F-box protein CPR30-like [Gossypium raimondii] gi|823256248|ref|XP_012460772.1| PREDICTED: F-box protein CPR30-like [Gossypium raimondii] gi|763808762|gb|KJB75664.1| hypothetical protein B456_012G050800 [Gossypium raimondii] gi|763808763|gb|KJB75665.1| hypothetical protein B456_012G050800 [Gossypium raimondii] Length = 385 Score = 56.2 bits (134), Expect = 9e-06 Identities = 25/50 (50%), Positives = 32/50 (64%) Frame = +2 Query: 251 DSPSDLTLNILTRLPADSVIQCKQVCKTWKDLLCQPSFPQAHLLHQLNGN 400 D P +L L IL RLPA+S+++CK VCK W L+ P F Q HL + N N Sbjct: 6 DLPRELFLEILLRLPAESLMRCKYVCKYWHSLITNPKFIQLHLNYNYNNN 55