BLASTX nr result
ID: Papaver30_contig00050323
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver30_contig00050323 (435 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_008234355.1| PREDICTED: uncharacterized protein LOC103333... 46 4e-06 >ref|XP_008234355.1| PREDICTED: uncharacterized protein LOC103333312 [Prunus mume] Length = 239 Score = 45.8 bits (107), Expect(2) = 4e-06 Identities = 20/34 (58%), Positives = 26/34 (76%) Frame = +3 Query: 183 KLSANNYPLWKSQIVLLLRSYDLFQFVDGSFHCP 284 KL+ +NYPLW +QI +LRS DLF +VDG+ CP Sbjct: 48 KLTRSNYPLWLAQISPILRSRDLFGYVDGTVLCP 81 Score = 31.6 bits (70), Expect(2) = 4e-06 Identities = 10/17 (58%), Positives = 13/17 (76%) Frame = +2 Query: 383 PAYAYWVNQDSALLSWL 433 P+Y YWV QD +LSW+ Sbjct: 95 PSYPYWVQQDQTILSWI 111