BLASTX nr result
ID: Papaver30_contig00050046
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver30_contig00050046 (934 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_001236183.1| uncharacterized protein LOC100500053 [Glycin... 67 2e-08 >ref|NP_001236183.1| uncharacterized protein LOC100500053 [Glycine max] gi|255628839|gb|ACU14764.1| unknown [Glycine max] Length = 92 Score = 67.4 bits (163), Expect = 2e-08 Identities = 31/42 (73%), Positives = 35/42 (83%) Frame = +2 Query: 2 FPMARSPLSKKNTIPRNEKKMPNPVNPSPIFFLSFISNETIL 127 FP+A +PLSKK PRNEK +PNPV P+PIFF SFISNETIL Sbjct: 49 FPIASNPLSKKKIRPRNEKNIPNPVKPNPIFFRSFISNETIL 90