BLASTX nr result
ID: Papaver30_contig00050023
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver30_contig00050023 (559 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010274648.1| PREDICTED: U-box domain-containing protein 4... 100 4e-19 ref|XP_010260385.1| PREDICTED: U-box domain-containing protein 4... 92 2e-16 ref|XP_010260305.1| PREDICTED: U-box domain-containing protein 4... 92 2e-16 ref|XP_004231992.1| PREDICTED: U-box domain-containing protein 2... 90 8e-16 ref|XP_004231991.1| PREDICTED: U-box domain-containing protein 2... 90 8e-16 ref|XP_006357777.1| PREDICTED: U-box domain-containing protein 4... 88 3e-15 ref|XP_006357776.1| PREDICTED: U-box domain-containing protein 4... 88 3e-15 ref|XP_012832595.1| PREDICTED: U-box domain-containing protein 3... 86 9e-15 ref|XP_009762966.1| PREDICTED: U-box domain-containing protein 2... 85 3e-14 ref|XP_010660332.1| PREDICTED: U-box domain-containing protein 4... 82 2e-13 ref|XP_009617192.1| PREDICTED: U-box domain-containing protein 2... 82 2e-13 ref|XP_002273909.1| PREDICTED: U-box domain-containing protein 4... 82 2e-13 ref|XP_009627994.1| PREDICTED: U-box domain-containing protein 4... 82 2e-13 ref|XP_006364015.1| PREDICTED: U-box domain-containing protein 4... 82 2e-13 emb|CDP02708.1| unnamed protein product [Coffea canephora] 81 3e-13 ref|XP_011097129.1| PREDICTED: U-box domain-containing protein 4... 80 6e-13 ref|XP_009611154.1| PREDICTED: U-box domain-containing protein 4... 79 1e-12 ref|XP_004233479.1| PREDICTED: U-box domain-containing protein 4... 79 1e-12 ref|XP_006346898.1| PREDICTED: U-box domain-containing protein 4... 78 3e-12 ref|XP_004234710.1| PREDICTED: U-box domain-containing protein 4... 77 7e-12 >ref|XP_010274648.1| PREDICTED: U-box domain-containing protein 4-like [Nelumbo nucifera] Length = 381 Score = 100 bits (250), Expect = 4e-19 Identities = 60/93 (64%), Positives = 70/93 (75%), Gaps = 9/93 (9%) Frame = -3 Query: 254 MEPDSQISETDS---------KIPEIVNQTMELLIQSSDPCSKIQAAKDIRRLTKTSQKY 102 ME +SQ S DS + IV+QT+EL IQS DP S+IQAA++IRRLTKTSQ+Y Sbjct: 1 MELESQFSGDDSSNSFGANTARTSAIVSQTIEL-IQSDDPVSRIQAAREIRRLTKTSQRY 59 Query: 101 RRHFSGAIQYLVSMLRSNSVEFNEASLLALLNL 3 RR FSGAI+ LVSMLRS S+E NEASLLALLNL Sbjct: 60 RRQFSGAIEPLVSMLRSESIECNEASLLALLNL 92 >ref|XP_010260385.1| PREDICTED: U-box domain-containing protein 4-like isoform X2 [Nelumbo nucifera] Length = 381 Score = 91.7 bits (226), Expect = 2e-16 Identities = 57/93 (61%), Positives = 68/93 (73%), Gaps = 9/93 (9%) Frame = -3 Query: 254 MEPDSQISETDS---------KIPEIVNQTMELLIQSSDPCSKIQAAKDIRRLTKTSQKY 102 ME +SQ S DS + IV QT+EL IQS D SKIQAA++IRRLTKTSQK+ Sbjct: 1 MESESQFSGDDSSRNLGASTVRKSAIVKQTIEL-IQSEDTESKIQAAREIRRLTKTSQKH 59 Query: 101 RRHFSGAIQYLVSMLRSNSVEFNEASLLALLNL 3 RR FSGAI+ L+SML+S+S+E EASLLALLNL Sbjct: 60 RRQFSGAIEPLLSMLKSDSLECKEASLLALLNL 92 >ref|XP_010260305.1| PREDICTED: U-box domain-containing protein 4-like isoform X1 [Nelumbo nucifera] Length = 420 Score = 91.7 bits (226), Expect = 2e-16 Identities = 57/93 (61%), Positives = 68/93 (73%), Gaps = 9/93 (9%) Frame = -3 Query: 254 MEPDSQISETDS---------KIPEIVNQTMELLIQSSDPCSKIQAAKDIRRLTKTSQKY 102 ME +SQ S DS + IV QT+EL IQS D SKIQAA++IRRLTKTSQK+ Sbjct: 1 MESESQFSGDDSSRNLGASTVRKSAIVKQTIEL-IQSEDTESKIQAAREIRRLTKTSQKH 59 Query: 101 RRHFSGAIQYLVSMLRSNSVEFNEASLLALLNL 3 RR FSGAI+ L+SML+S+S+E EASLLALLNL Sbjct: 60 RRQFSGAIEPLLSMLKSDSLECKEASLLALLNL 92 >ref|XP_004231992.1| PREDICTED: U-box domain-containing protein 2 isoform X2 [Solanum lycopersicum] Length = 373 Score = 89.7 bits (221), Expect = 8e-16 Identities = 48/67 (71%), Positives = 55/67 (82%) Frame = -3 Query: 203 VNQTMELLIQSSDPCSKIQAAKDIRRLTKTSQKYRRHFSGAIQYLVSMLRSNSVEFNEAS 24 V QT+ LIQS DP K+QAAK+IRRLTKTSQ+YRRHFS A++ LV MLRS S E NEA+ Sbjct: 35 VQQTL-FLIQSDDPTLKVQAAKEIRRLTKTSQRYRRHFSNAVKPLVDMLRSESFESNEAA 93 Query: 23 LLALLNL 3 LLALLNL Sbjct: 94 LLALLNL 100 >ref|XP_004231991.1| PREDICTED: U-box domain-containing protein 2 isoform X1 [Solanum lycopersicum] Length = 389 Score = 89.7 bits (221), Expect = 8e-16 Identities = 48/67 (71%), Positives = 55/67 (82%) Frame = -3 Query: 203 VNQTMELLIQSSDPCSKIQAAKDIRRLTKTSQKYRRHFSGAIQYLVSMLRSNSVEFNEAS 24 V QT+ LIQS DP K+QAAK+IRRLTKTSQ+YRRHFS A++ LV MLRS S E NEA+ Sbjct: 35 VQQTL-FLIQSDDPTLKVQAAKEIRRLTKTSQRYRRHFSNAVKPLVDMLRSESFESNEAA 93 Query: 23 LLALLNL 3 LLALLNL Sbjct: 94 LLALLNL 100 >ref|XP_006357777.1| PREDICTED: U-box domain-containing protein 4-like isoform X2 [Solanum tuberosum] Length = 373 Score = 87.8 bits (216), Expect = 3e-15 Identities = 47/67 (70%), Positives = 54/67 (80%) Frame = -3 Query: 203 VNQTMELLIQSSDPCSKIQAAKDIRRLTKTSQKYRRHFSGAIQYLVSMLRSNSVEFNEAS 24 V QT+ LI S DP K+QAAK+IRRLTKTSQ+YRRHFS A++ LV MLRS S E NEA+ Sbjct: 35 VQQTL-FLIHSDDPTLKVQAAKEIRRLTKTSQRYRRHFSNAVKPLVDMLRSESFESNEAA 93 Query: 23 LLALLNL 3 LLALLNL Sbjct: 94 LLALLNL 100 >ref|XP_006357776.1| PREDICTED: U-box domain-containing protein 4-like isoform X1 [Solanum tuberosum] Length = 389 Score = 87.8 bits (216), Expect = 3e-15 Identities = 47/67 (70%), Positives = 54/67 (80%) Frame = -3 Query: 203 VNQTMELLIQSSDPCSKIQAAKDIRRLTKTSQKYRRHFSGAIQYLVSMLRSNSVEFNEAS 24 V QT+ LI S DP K+QAAK+IRRLTKTSQ+YRRHFS A++ LV MLRS S E NEA+ Sbjct: 35 VQQTL-FLIHSDDPTLKVQAAKEIRRLTKTSQRYRRHFSNAVKPLVDMLRSESFESNEAA 93 Query: 23 LLALLNL 3 LLALLNL Sbjct: 94 LLALLNL 100 >ref|XP_012832595.1| PREDICTED: U-box domain-containing protein 3 [Erythranthe guttatus] gi|604342267|gb|EYU41331.1| hypothetical protein MIMGU_mgv1a008704mg [Erythranthe guttata] Length = 365 Score = 86.3 bits (212), Expect = 9e-15 Identities = 48/77 (62%), Positives = 57/77 (74%) Frame = -3 Query: 233 SETDSKIPEIVNQTMELLIQSSDPCSKIQAAKDIRRLTKTSQKYRRHFSGAIQYLVSMLR 54 S S VNQT+ +L+QS DP S++ AAKDIRRLTKTSQ+ RRHFSGA+ LV MLR Sbjct: 10 SSLSSSSAATVNQTL-VLLQSDDPNSRVLAAKDIRRLTKTSQRSRRHFSGAVGPLVDMLR 68 Query: 53 SNSVEFNEASLLALLNL 3 +S E NEA+L ALLNL Sbjct: 69 CSSAEANEAALAALLNL 85 >ref|XP_009762966.1| PREDICTED: U-box domain-containing protein 2-like [Nicotiana sylvestris] Length = 388 Score = 84.7 bits (208), Expect = 3e-14 Identities = 50/81 (61%), Positives = 57/81 (70%) Frame = -3 Query: 245 DSQISETDSKIPEIVNQTMELLIQSSDPCSKIQAAKDIRRLTKTSQKYRRHFSGAIQYLV 66 D I T S V QT+ LI S D K+QAAK+IRRLTKTSQ+YRRHFS A++ LV Sbjct: 22 DGPIRRTTSS--SAVQQTL-FLIHSDDLTLKVQAAKEIRRLTKTSQRYRRHFSNAVKPLV 78 Query: 65 SMLRSNSVEFNEASLLALLNL 3 MLRS S E NEA+LLALLNL Sbjct: 79 DMLRSESFESNEAALLALLNL 99 >ref|XP_010660332.1| PREDICTED: U-box domain-containing protein 4 isoform X1 [Vitis vinifera] Length = 381 Score = 82.0 bits (201), Expect = 2e-13 Identities = 49/83 (59%), Positives = 63/83 (75%) Frame = -3 Query: 251 EPDSQISETDSKIPEIVNQTMELLIQSSDPCSKIQAAKDIRRLTKTSQKYRRHFSGAIQY 72 +PD+ + T + VN+T+ LL QS DP S+IQAAK+IRRLTKTSQK RR S A++ Sbjct: 13 DPDTPRTATTA-----VNRTLHLL-QSDDPDSQIQAAKEIRRLTKTSQKCRRQLSPAVRP 66 Query: 71 LVSMLRSNSVEFNEASLLALLNL 3 LVSMLR +S++ NEA+LLALLNL Sbjct: 67 LVSMLRLDSLDSNEAALLALLNL 89 >ref|XP_009617192.1| PREDICTED: U-box domain-containing protein 2 [Nicotiana tomentosiformis] Length = 390 Score = 82.0 bits (201), Expect = 2e-13 Identities = 49/81 (60%), Positives = 56/81 (69%) Frame = -3 Query: 245 DSQISETDSKIPEIVNQTMELLIQSSDPCSKIQAAKDIRRLTKTSQKYRRHFSGAIQYLV 66 D I T S V QT+ LI S D K+QAAK+IRRLTKTSQ+YRRHFS A++ LV Sbjct: 24 DGDIRRTTSS--SAVQQTL-FLIHSDDLTLKVQAAKEIRRLTKTSQRYRRHFSNAVKPLV 80 Query: 65 SMLRSNSVEFNEASLLALLNL 3 ML S S E NEA+LLALLNL Sbjct: 81 DMLCSESFESNEAALLALLNL 101 >ref|XP_002273909.1| PREDICTED: U-box domain-containing protein 4 isoform X2 [Vitis vinifera] gi|147807233|emb|CAN61950.1| hypothetical protein VITISV_002189 [Vitis vinifera] Length = 378 Score = 82.0 bits (201), Expect = 2e-13 Identities = 49/83 (59%), Positives = 63/83 (75%) Frame = -3 Query: 251 EPDSQISETDSKIPEIVNQTMELLIQSSDPCSKIQAAKDIRRLTKTSQKYRRHFSGAIQY 72 +PD+ + T + VN+T+ LL QS DP S+IQAAK+IRRLTKTSQK RR S A++ Sbjct: 13 DPDTPRTATTA-----VNRTLHLL-QSDDPDSQIQAAKEIRRLTKTSQKCRRQLSPAVRP 66 Query: 71 LVSMLRSNSVEFNEASLLALLNL 3 LVSMLR +S++ NEA+LLALLNL Sbjct: 67 LVSMLRLDSLDSNEAALLALLNL 89 >ref|XP_009627994.1| PREDICTED: U-box domain-containing protein 4-like [Nicotiana tomentosiformis] Length = 360 Score = 81.6 bits (200), Expect = 2e-13 Identities = 43/68 (63%), Positives = 54/68 (79%) Frame = -3 Query: 206 IVNQTMELLIQSSDPCSKIQAAKDIRRLTKTSQKYRRHFSGAIQYLVSMLRSNSVEFNEA 27 IV +T+ L+QS DP K+Q A+DIRRLTK+S +YRRHFS A++ LV MLRS S EF +A Sbjct: 5 IVEKTL-YLVQSEDPILKVQGARDIRRLTKSSLRYRRHFSDAVKPLVDMLRSTSFEFIQA 63 Query: 26 SLLALLNL 3 +LLALLNL Sbjct: 64 ALLALLNL 71 >ref|XP_006364015.1| PREDICTED: U-box domain-containing protein 4-like [Solanum tuberosum] Length = 361 Score = 81.6 bits (200), Expect = 2e-13 Identities = 46/69 (66%), Positives = 56/69 (81%), Gaps = 1/69 (1%) Frame = -3 Query: 206 IVNQTMELLIQSSDPCSKIQAAKDIRRLTKTSQKYRRHFSGAIQYLVSMLR-SNSVEFNE 30 IV +T+ LIQS DP K+Q A+DIRRLTK+S +YRRHFS A++ LV MLR S SVE+NE Sbjct: 5 IVEKTL-YLIQSDDPILKLQGARDIRRLTKSSLRYRRHFSDAVKPLVDMLRNSPSVEYNE 63 Query: 29 ASLLALLNL 3 A+LLALLNL Sbjct: 64 AALLALLNL 72 >emb|CDP02708.1| unnamed protein product [Coffea canephora] Length = 188 Score = 81.3 bits (199), Expect = 3e-13 Identities = 49/93 (52%), Positives = 64/93 (68%), Gaps = 4/93 (4%) Frame = -3 Query: 269 TANRNMEPDSQI---SETDSKIPEIVNQTMELLIQSSDPCSKIQAAKDIRRLTKTSQKYR 99 T PD+ + S + SK+ EI++ LIQS D K++AA++IRRL KTSQ+YR Sbjct: 21 TTTAGASPDTDVPLRSPSPSKVSEILH-----LIQSDDLQQKVEAAREIRRLAKTSQRYR 75 Query: 98 RHFSGAIQYLVSM-LRSNSVEFNEASLLALLNL 3 RHFS A++ LV M L +NSVE NEA+LLALLNL Sbjct: 76 RHFSDAVKPLVQMLLYANSVEANEAALLALLNL 108 >ref|XP_011097129.1| PREDICTED: U-box domain-containing protein 4 [Sesamum indicum] Length = 394 Score = 80.1 bits (196), Expect = 6e-13 Identities = 41/67 (61%), Positives = 52/67 (77%) Frame = -3 Query: 203 VNQTMELLIQSSDPCSKIQAAKDIRRLTKTSQKYRRHFSGAIQYLVSMLRSNSVEFNEAS 24 V QT+ +L++S DP ++QAAKDIRRLTKTSQ+YRRHFSGA+ LV ML + NEA+ Sbjct: 40 VTQTL-MLLESDDPNLRVQAAKDIRRLTKTSQRYRRHFSGAVGPLVDMLHCGCADANEAA 98 Query: 23 LLALLNL 3 L A+LNL Sbjct: 99 LAAILNL 105 >ref|XP_009611154.1| PREDICTED: U-box domain-containing protein 45-like [Nicotiana tomentosiformis] Length = 372 Score = 79.3 bits (194), Expect = 1e-12 Identities = 45/68 (66%), Positives = 55/68 (80%), Gaps = 1/68 (1%) Frame = -3 Query: 203 VNQTMELLIQSSDPCSKIQAAKDIRRLTKTSQKYRRHFSGAIQYLVSMLRS-NSVEFNEA 27 VN+ + LLIQS DP K+QAA +IRRLTKTS++YRR+FS A++ LV MLRS NS E EA Sbjct: 20 VNRNL-LLIQSDDPILKVQAAMEIRRLTKTSKRYRRYFSNAVKPLVDMLRSTNSFESKEA 78 Query: 26 SLLALLNL 3 +LLALLNL Sbjct: 79 ALLALLNL 86 >ref|XP_004233479.1| PREDICTED: U-box domain-containing protein 4-like [Solanum lycopersicum] Length = 419 Score = 79.0 bits (193), Expect = 1e-12 Identities = 41/61 (67%), Positives = 50/61 (81%) Frame = -3 Query: 185 LLIQSSDPCSKIQAAKDIRRLTKTSQKYRRHFSGAIQYLVSMLRSNSVEFNEASLLALLN 6 LLIQS D K+QAA++IRRLTKTS++YRR+FS A++ LV ML SNS E EA+LLALLN Sbjct: 74 LLIQSDDLTLKVQAAREIRRLTKTSKRYRRYFSNAVKSLVHMLHSNSFESKEAALLALLN 133 Query: 5 L 3 L Sbjct: 134 L 134 >ref|XP_006346898.1| PREDICTED: U-box domain-containing protein 4-like [Solanum tuberosum] Length = 377 Score = 77.8 bits (190), Expect = 3e-12 Identities = 40/61 (65%), Positives = 50/61 (81%) Frame = -3 Query: 185 LLIQSSDPCSKIQAAKDIRRLTKTSQKYRRHFSGAIQYLVSMLRSNSVEFNEASLLALLN 6 LLIQS D K+QAA++IRRLTKTS++YRR+FS +++ LV ML SNS E EA+LLALLN Sbjct: 32 LLIQSDDLTLKVQAAREIRRLTKTSKRYRRYFSNSVKSLVHMLHSNSFESKEAALLALLN 91 Query: 5 L 3 L Sbjct: 92 L 92 >ref|XP_004234710.1| PREDICTED: U-box domain-containing protein 4-like isoform X1 [Solanum lycopersicum] Length = 361 Score = 76.6 bits (187), Expect = 7e-12 Identities = 44/69 (63%), Positives = 55/69 (79%), Gaps = 1/69 (1%) Frame = -3 Query: 206 IVNQTMELLIQSSDPCSKIQAAKDIRRLTKTSQKYRRHFSGAIQYLVSMLR-SNSVEFNE 30 IV +T+ LIQS +P K+Q A+DIRRLTK+ +YRR+FS AI+ LV MLR S SVE+NE Sbjct: 5 IVEKTL-YLIQSDNPILKLQGARDIRRLTKSCLRYRRYFSDAIKPLVDMLRHSESVEYNE 63 Query: 29 ASLLALLNL 3 A+LLALLNL Sbjct: 64 AALLALLNL 72