BLASTX nr result
ID: Papaver30_contig00049306
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver30_contig00049306 (713 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KJB32148.1| hypothetical protein B456_005G226200, partial [Go... 60 2e-06 >gb|KJB32148.1| hypothetical protein B456_005G226200, partial [Gossypium raimondii] Length = 82 Score = 59.7 bits (143), Expect = 2e-06 Identities = 34/62 (54%), Positives = 43/62 (69%), Gaps = 1/62 (1%) Frame = -3 Query: 594 FSFEFVFDELFS-YSQAVCIEGP*NIGMSVLRKQRVHVIQEDFEILAAKVMKKET*KNRS 418 F F + ++L+S + QAVC E GM LR++RVHV QEDFE+ AKVMKKE+ KN S Sbjct: 21 FVFVLICEKLYSVFLQAVCTES----GMFALRERRVHVTQEDFEMAVAKVMKKESEKNMS 76 Query: 417 LR 412 LR Sbjct: 77 LR 78