BLASTX nr result
ID: Papaver30_contig00048961
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver30_contig00048961 (407 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN70693.1| hypothetical protein VITISV_041975 [Vitis vinifera] 54 4e-06 >emb|CAN70693.1| hypothetical protein VITISV_041975 [Vitis vinifera] Length = 1795 Score = 53.5 bits (127), Expect(2) = 4e-06 Identities = 24/58 (41%), Positives = 34/58 (58%) Frame = +3 Query: 72 FAYANSSSTPVMNSIYKWLFSPEIEEHYPMDLQLSQPRPVSDHIPPLLNTNVESWEPT 245 F ++N +PV + ++L+S E E H+P LQ + PR SDH P +L TN W PT Sbjct: 996 FTWSNMQESPVCKRLDRFLYSNEWEHHFPQSLQEALPRRTSDHWPIVLETNXFKWGPT 1053 Score = 23.5 bits (49), Expect(2) = 4e-06 Identities = 10/21 (47%), Positives = 13/21 (61%) Frame = +1 Query: 244 PPPFRFENT*NSWIQRSNYIE 306 P PFRFE N W+Q ++ E Sbjct: 1052 PTPFRFE---NMWLQHPSFKE 1069