BLASTX nr result
ID: Papaver30_contig00048960
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver30_contig00048960 (653 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN68400.1| hypothetical protein VITISV_041172 [Vitis vinifera] 48 4e-06 >emb|CAN68400.1| hypothetical protein VITISV_041172 [Vitis vinifera] Length = 1944 Score = 48.1 bits (113), Expect(2) = 4e-06 Identities = 22/59 (37%), Positives = 35/59 (59%) Frame = +1 Query: 316 NFAYANSSSTPVMNSIYKWLFSPEIEEHYPMDLQLAQPRPASDRIPLLLNTNVESWEPT 492 +FA++N +PV + ++L+S E + +P LQ A PR D P++L+TN W PT Sbjct: 761 SFAWSNMQESPVCKRLNRFLYSNEGGQFFPQXLQEALPRRTXDHWPIVLDTNXFKWGPT 819 Score = 29.6 bits (65), Expect(2) = 4e-06 Identities = 19/41 (46%), Positives = 22/41 (53%) Frame = +2 Query: 164 GPNYPRLRKGFVGVELNDDFAISCGGAWVLGDGFNTLFEES 286 GPN P LRK F VEL D F +S W +G FN + S Sbjct: 690 GPNNPLLRKDF-WVELLDIFGLSF-PLWCVGGDFNVIRRSS 728