BLASTX nr result
ID: Papaver30_contig00048802
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver30_contig00048802 (503 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003604021.1| transmembrane protein, putative [Medicago tr... 64 3e-08 gb|KMT14057.1| hypothetical protein BVRB_4g078840 isoform B [Bet... 60 5e-07 gb|KMT14056.1| hypothetical protein BVRB_4g078840 isoform A [Bet... 57 4e-06 gb|KMT14058.1| hypothetical protein BVRB_4g078840 isoform C [Bet... 56 9e-06 >ref|XP_003604021.1| transmembrane protein, putative [Medicago truncatula] gi|355493069|gb|AES74272.1| transmembrane protein, putative [Medicago truncatula] Length = 127 Score = 64.3 bits (155), Expect = 3e-08 Identities = 41/85 (48%), Positives = 50/85 (58%), Gaps = 3/85 (3%) Frame = -2 Query: 280 SRYVRVVKETDLKSVGLCPRRFEPCCRRNHNFELIASFLVYT---LDFSGFVFCLRFYVV 110 SRYVRVVKETDLKSVGL PRRFEPCCRR F S +++T ++ + F L FY + Sbjct: 38 SRYVRVVKETDLKSVGLRPRRFEPCCRRAFFFLFFYSHIIFTPVGINDNDF-GTLPFYAI 96 Query: 109 VADDDVSLCL*LIASIVVYSGFLWL 35 DD S+ S FL+L Sbjct: 97 NMDD---------GSLFTDSSFLFL 112 >gb|KMT14057.1| hypothetical protein BVRB_4g078840 isoform B [Beta vulgaris subsp. vulgaris] Length = 124 Score = 60.5 bits (145), Expect = 5e-07 Identities = 29/47 (61%), Positives = 34/47 (72%) Frame = +2 Query: 143 GEI*CVN*KRSYQFKIMISSTAWFEPARAKPNRFQVCLLNHSDISTF 283 G++ C+ + +STA FEPARAKPNRFQVCLLNHSDISTF Sbjct: 25 GQLICIKHVSGLVKDVHAASTAGFEPARAKPNRFQVCLLNHSDISTF 71 >gb|KMT14056.1| hypothetical protein BVRB_4g078840 isoform A [Beta vulgaris subsp. vulgaris] Length = 45 Score = 57.4 bits (137), Expect = 4e-06 Identities = 29/39 (74%), Positives = 32/39 (82%) Frame = +3 Query: 168 KEAISSKL*FRRQHGSNLRGQSPTDFKSVSLTTRTYRLL 284 K+ S+ +RRQ GSNLRGQSPTDFKSVSLTTRTYR L Sbjct: 5 KDDKKSQFRWRRQQGSNLRGQSPTDFKSVSLTTRTYRHL 43 >gb|KMT14058.1| hypothetical protein BVRB_4g078840 isoform C [Beta vulgaris subsp. vulgaris] Length = 40 Score = 56.2 bits (134), Expect = 9e-06 Identities = 27/30 (90%), Positives = 28/30 (93%) Frame = +3 Query: 195 FRRQHGSNLRGQSPTDFKSVSLTTRTYRLL 284 +RRQ GSNLRGQSPTDFKSVSLTTRTYR L Sbjct: 9 WRRQQGSNLRGQSPTDFKSVSLTTRTYRHL 38