BLASTX nr result
ID: Papaver30_contig00048354
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver30_contig00048354 (720 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010258183.1| PREDICTED: probable ubiquitin conjugation fa... 65 6e-08 gb|EPS64850.1| hypothetical protein M569_09926 [Genlisea aurea] 60 2e-06 ref|XP_012084775.1| PREDICTED: probable ubiquitin conjugation fa... 59 2e-06 ref|XP_012084776.1| PREDICTED: probable ubiquitin conjugation fa... 59 2e-06 gb|KHG03448.1| putative ubiquitin conjugation factor E4 -like pr... 59 3e-06 ref|XP_003618612.2| ubiquitin conjugation factor E4, putative [M... 59 3e-06 gb|KDO72692.1| hypothetical protein CISIN_1g001583mg [Citrus sin... 59 3e-06 gb|KDO72691.1| hypothetical protein CISIN_1g001583mg [Citrus sin... 59 3e-06 gb|KDO72690.1| hypothetical protein CISIN_1g001583mg [Citrus sin... 59 3e-06 gb|KDO72689.1| hypothetical protein CISIN_1g001583mg [Citrus sin... 59 3e-06 gb|KDO72688.1| hypothetical protein CISIN_1g001583mg [Citrus sin... 59 3e-06 ref|XP_006482712.1| PREDICTED: probable ubiquitin conjugation fa... 59 3e-06 ref|XP_006431253.1| hypothetical protein CICLE_v10010958mg [Citr... 59 3e-06 ref|XP_006431252.1| hypothetical protein CICLE_v10010958mg [Citr... 59 3e-06 ref|XP_006431249.1| hypothetical protein CICLE_v10010958mg [Citr... 59 3e-06 ref|XP_006431248.1| hypothetical protein CICLE_v10010958mg [Citr... 59 3e-06 ref|XP_011625050.1| PREDICTED: probable ubiquitin conjugation fa... 59 4e-06 emb|CDP02278.1| unnamed protein product [Coffea canephora] 59 4e-06 ref|XP_002532897.1| ubiquitin-protein ligase, putative [Ricinus ... 59 4e-06 gb|ERN10305.1| hypothetical protein AMTR_s00177p00048180, partia... 59 4e-06 >ref|XP_010258183.1| PREDICTED: probable ubiquitin conjugation factor E4 [Nelumbo nucifera] Length = 1032 Score = 64.7 bits (156), Expect = 6e-08 Identities = 33/72 (45%), Positives = 48/72 (66%) Frame = -1 Query: 252 FSAMDAVVKQAKRLTVSCGGNTQYNFVCECFFMTTRVLNLGLLRSFSGYMHLAQMLK*KD 73 +S+ +++ AK ++ SCG +YNF+CECFFMT RVLNLGL+++FS Y HL Q L + Sbjct: 445 YSSGLSLLSNAKPMS-SCGVKIKYNFICECFFMTARVLNLGLVKAFSDYKHLIQDLSRCE 503 Query: 72 QVNRS*PHLQQQ 37 S +Q+Q Sbjct: 504 NTLSSLKAMQEQ 515 >gb|EPS64850.1| hypothetical protein M569_09926 [Genlisea aurea] Length = 1039 Score = 59.7 bits (143), Expect = 2e-06 Identities = 25/50 (50%), Positives = 38/50 (76%) Frame = -1 Query: 240 DAVVKQAKRLTVSCGGNTQYNFVCECFFMTTRVLNLGLLRSFSGYMHLAQ 91 ++ ++Q+ + + G +Y F+CECFFMTTRVLNLGLL++FS + HL+Q Sbjct: 447 ESSLRQSTGASSTSRGKAKYPFICECFFMTTRVLNLGLLKAFSDFKHLSQ 496 >ref|XP_012084775.1| PREDICTED: probable ubiquitin conjugation factor E4 isoform X1 [Jatropha curcas] Length = 1039 Score = 59.3 bits (142), Expect = 2e-06 Identities = 26/44 (59%), Positives = 32/44 (72%) Frame = -1 Query: 222 AKRLTVSCGGNTQYNFVCECFFMTTRVLNLGLLRSFSGYMHLAQ 91 A + T S G +Y F+CECFFMT RVLNLGLL++FS + HL Q Sbjct: 442 ADKPTSSSGKKVKYTFICECFFMTARVLNLGLLKAFSDFKHLVQ 485 >ref|XP_012084776.1| PREDICTED: probable ubiquitin conjugation factor E4 isoform X2 [Jatropha curcas] gi|643714847|gb|KDP27202.1| hypothetical protein JCGZ_19901 [Jatropha curcas] Length = 1026 Score = 59.3 bits (142), Expect = 2e-06 Identities = 26/44 (59%), Positives = 32/44 (72%) Frame = -1 Query: 222 AKRLTVSCGGNTQYNFVCECFFMTTRVLNLGLLRSFSGYMHLAQ 91 A + T S G +Y F+CECFFMT RVLNLGLL++FS + HL Q Sbjct: 442 ADKPTSSSGKKVKYTFICECFFMTARVLNLGLLKAFSDFKHLVQ 485 >gb|KHG03448.1| putative ubiquitin conjugation factor E4 -like protein [Gossypium arboreum] Length = 1046 Score = 58.9 bits (141), Expect = 3e-06 Identities = 25/40 (62%), Positives = 30/40 (75%) Frame = -1 Query: 210 TVSCGGNTQYNFVCECFFMTTRVLNLGLLRSFSGYMHLAQ 91 T S G Y+F+CECFFMT RVLNLGLL++FS + HL Q Sbjct: 467 TRSSSGKANYHFICECFFMTARVLNLGLLKAFSDFKHLVQ 506 >ref|XP_003618612.2| ubiquitin conjugation factor E4, putative [Medicago truncatula] gi|657381012|gb|AES74830.2| ubiquitin conjugation factor E4, putative [Medicago truncatula] Length = 1047 Score = 58.9 bits (141), Expect = 3e-06 Identities = 27/56 (48%), Positives = 38/56 (67%) Frame = -1 Query: 204 SCGGNTQYNFVCECFFMTTRVLNLGLLRSFSGYMHLAQMLK*KDQVNRS*PHLQQQ 37 S + +Y+F+CECFFMT RVLNLGLL++FS Y HLAQ + + + +Q+Q Sbjct: 468 SNNASPKYSFICECFFMTARVLNLGLLKAFSDYKHLAQDISRSEDTLSTLKTMQEQ 523 >gb|KDO72692.1| hypothetical protein CISIN_1g001583mg [Citrus sinensis] Length = 877 Score = 58.9 bits (141), Expect = 3e-06 Identities = 24/36 (66%), Positives = 30/36 (83%) Frame = -1 Query: 198 GGNTQYNFVCECFFMTTRVLNLGLLRSFSGYMHLAQ 91 GG ++Y F+CECFFMT RVLNLGLL++FS + HL Q Sbjct: 472 GGKSKYPFICECFFMTARVLNLGLLKAFSDFKHLVQ 507 >gb|KDO72691.1| hypothetical protein CISIN_1g001583mg [Citrus sinensis] Length = 927 Score = 58.9 bits (141), Expect = 3e-06 Identities = 24/36 (66%), Positives = 30/36 (83%) Frame = -1 Query: 198 GGNTQYNFVCECFFMTTRVLNLGLLRSFSGYMHLAQ 91 GG ++Y F+CECFFMT RVLNLGLL++FS + HL Q Sbjct: 472 GGKSKYPFICECFFMTARVLNLGLLKAFSDFKHLVQ 507 >gb|KDO72690.1| hypothetical protein CISIN_1g001583mg [Citrus sinensis] Length = 1002 Score = 58.9 bits (141), Expect = 3e-06 Identities = 24/36 (66%), Positives = 30/36 (83%) Frame = -1 Query: 198 GGNTQYNFVCECFFMTTRVLNLGLLRSFSGYMHLAQ 91 GG ++Y F+CECFFMT RVLNLGLL++FS + HL Q Sbjct: 472 GGKSKYPFICECFFMTARVLNLGLLKAFSDFKHLVQ 507 >gb|KDO72689.1| hypothetical protein CISIN_1g001583mg [Citrus sinensis] Length = 981 Score = 58.9 bits (141), Expect = 3e-06 Identities = 24/36 (66%), Positives = 30/36 (83%) Frame = -1 Query: 198 GGNTQYNFVCECFFMTTRVLNLGLLRSFSGYMHLAQ 91 GG ++Y F+CECFFMT RVLNLGLL++FS + HL Q Sbjct: 472 GGKSKYPFICECFFMTARVLNLGLLKAFSDFKHLVQ 507 >gb|KDO72688.1| hypothetical protein CISIN_1g001583mg [Citrus sinensis] Length = 1049 Score = 58.9 bits (141), Expect = 3e-06 Identities = 24/36 (66%), Positives = 30/36 (83%) Frame = -1 Query: 198 GGNTQYNFVCECFFMTTRVLNLGLLRSFSGYMHLAQ 91 GG ++Y F+CECFFMT RVLNLGLL++FS + HL Q Sbjct: 472 GGKSKYPFICECFFMTARVLNLGLLKAFSDFKHLVQ 507 >ref|XP_006482712.1| PREDICTED: probable ubiquitin conjugation factor E4-like [Citrus sinensis] Length = 1049 Score = 58.9 bits (141), Expect = 3e-06 Identities = 24/36 (66%), Positives = 30/36 (83%) Frame = -1 Query: 198 GGNTQYNFVCECFFMTTRVLNLGLLRSFSGYMHLAQ 91 GG ++Y F+CECFFMT RVLNLGLL++FS + HL Q Sbjct: 472 GGKSKYPFICECFFMTARVLNLGLLKAFSDFKHLVQ 507 >ref|XP_006431253.1| hypothetical protein CICLE_v10010958mg [Citrus clementina] gi|557533310|gb|ESR44493.1| hypothetical protein CICLE_v10010958mg [Citrus clementina] Length = 732 Score = 58.9 bits (141), Expect = 3e-06 Identities = 24/36 (66%), Positives = 30/36 (83%) Frame = -1 Query: 198 GGNTQYNFVCECFFMTTRVLNLGLLRSFSGYMHLAQ 91 GG ++Y F+CECFFMT RVLNLGLL++FS + HL Q Sbjct: 202 GGKSKYPFICECFFMTARVLNLGLLKAFSDFKHLVQ 237 >ref|XP_006431252.1| hypothetical protein CICLE_v10010958mg [Citrus clementina] gi|557533309|gb|ESR44492.1| hypothetical protein CICLE_v10010958mg [Citrus clementina] Length = 779 Score = 58.9 bits (141), Expect = 3e-06 Identities = 24/36 (66%), Positives = 30/36 (83%) Frame = -1 Query: 198 GGNTQYNFVCECFFMTTRVLNLGLLRSFSGYMHLAQ 91 GG ++Y F+CECFFMT RVLNLGLL++FS + HL Q Sbjct: 202 GGKSKYPFICECFFMTARVLNLGLLKAFSDFKHLVQ 237 >ref|XP_006431249.1| hypothetical protein CICLE_v10010958mg [Citrus clementina] gi|557533306|gb|ESR44489.1| hypothetical protein CICLE_v10010958mg [Citrus clementina] Length = 1049 Score = 58.9 bits (141), Expect = 3e-06 Identities = 24/36 (66%), Positives = 30/36 (83%) Frame = -1 Query: 198 GGNTQYNFVCECFFMTTRVLNLGLLRSFSGYMHLAQ 91 GG ++Y F+CECFFMT RVLNLGLL++FS + HL Q Sbjct: 472 GGKSKYPFICECFFMTARVLNLGLLKAFSDFKHLVQ 507 >ref|XP_006431248.1| hypothetical protein CICLE_v10010958mg [Citrus clementina] gi|557533305|gb|ESR44488.1| hypothetical protein CICLE_v10010958mg [Citrus clementina] Length = 1002 Score = 58.9 bits (141), Expect = 3e-06 Identities = 24/36 (66%), Positives = 30/36 (83%) Frame = -1 Query: 198 GGNTQYNFVCECFFMTTRVLNLGLLRSFSGYMHLAQ 91 GG ++Y F+CECFFMT RVLNLGLL++FS + HL Q Sbjct: 472 GGKSKYPFICECFFMTARVLNLGLLKAFSDFKHLVQ 507 >ref|XP_011625050.1| PREDICTED: probable ubiquitin conjugation factor E4 [Amborella trichopoda] Length = 1002 Score = 58.5 bits (140), Expect = 4e-06 Identities = 28/55 (50%), Positives = 38/55 (69%) Frame = -1 Query: 249 SAMDAVVKQAKRLTVSCGGNTQYNFVCECFFMTTRVLNLGLLRSFSGYMHLAQML 85 S+ + V+ K L S G + Y F+CECFF+T RVLNLGLL++FS Y ++AQ L Sbjct: 430 SSGNNVLSNTKPLLNSRGTSKNYKFICECFFLTARVLNLGLLKAFSDYKNIAQDL 484 >emb|CDP02278.1| unnamed protein product [Coffea canephora] Length = 1031 Score = 58.5 bits (140), Expect = 4e-06 Identities = 23/37 (62%), Positives = 30/37 (81%) Frame = -1 Query: 201 CGGNTQYNFVCECFFMTTRVLNLGLLRSFSGYMHLAQ 91 C N +++F+CECFFMT RVLNLGLL++FS + HL Q Sbjct: 454 CSKNAKFSFICECFFMTARVLNLGLLKAFSDFKHLVQ 490 >ref|XP_002532897.1| ubiquitin-protein ligase, putative [Ricinus communis] gi|223527331|gb|EEF29477.1| ubiquitin-protein ligase, putative [Ricinus communis] Length = 1031 Score = 58.5 bits (140), Expect = 4e-06 Identities = 25/40 (62%), Positives = 30/40 (75%) Frame = -1 Query: 210 TVSCGGNTQYNFVCECFFMTTRVLNLGLLRSFSGYMHLAQ 91 T S G +Y F+CECFFMT RVLNLGLL++FS + HL Q Sbjct: 451 TSSSGQKAKYTFICECFFMTARVLNLGLLKAFSDFKHLVQ 490 >gb|ERN10305.1| hypothetical protein AMTR_s00177p00048180, partial [Amborella trichopoda] Length = 848 Score = 58.5 bits (140), Expect = 4e-06 Identities = 28/55 (50%), Positives = 38/55 (69%) Frame = -1 Query: 249 SAMDAVVKQAKRLTVSCGGNTQYNFVCECFFMTTRVLNLGLLRSFSGYMHLAQML 85 S+ + V+ K L S G + Y F+CECFF+T RVLNLGLL++FS Y ++AQ L Sbjct: 256 SSGNNVLSNTKPLLNSRGTSKNYKFICECFFLTARVLNLGLLKAFSDYKNIAQDL 310