BLASTX nr result
ID: Papaver30_contig00047377
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver30_contig00047377 (651 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010241541.1| PREDICTED: actin-related protein 6 isoform X... 195 2e-47 ref|XP_014508589.1| PREDICTED: actin-related protein 6 [Vigna ra... 191 3e-46 ref|XP_002285295.1| PREDICTED: actin-related protein 6 [Vitis vi... 189 9e-46 ref|XP_006450878.1| hypothetical protein CICLE_v10008344mg [Citr... 189 9e-46 ref|XP_012081220.1| PREDICTED: actin-related protein 6 [Jatropha... 189 1e-45 gb|KDP30265.1| hypothetical protein JCGZ_17047 [Jatropha curcas] 189 1e-45 gb|KHN08098.1| Actin-related protein 6 [Glycine soja] 189 2e-45 ref|XP_007153824.1| hypothetical protein PHAVU_003G068000g [Phas... 189 2e-45 ref|XP_003522640.1| PREDICTED: actin-related protein 6-like isof... 189 2e-45 ref|XP_010934377.1| PREDICTED: actin-related protein 6-like isof... 188 2e-45 ref|XP_002324643.1| Actin-related family protein [Populus tricho... 188 2e-45 ref|XP_006372160.1| hypothetical protein POPTR_0018s12840g [Popu... 188 2e-45 gb|KOM31459.1| hypothetical protein LR48_Vigan01g101400 [Vigna a... 188 3e-45 ref|XP_007013498.1| Actin related protein isoform 1 [Theobroma c... 188 3e-45 ref|XP_011084105.1| PREDICTED: actin-related protein 6 [Sesamum ... 187 4e-45 ref|XP_009385692.1| PREDICTED: actin-related protein 6 isoform X... 187 5e-45 ref|XP_011017795.1| PREDICTED: actin-related protein 6 [Populus ... 187 6e-45 ref|XP_010050051.1| PREDICTED: actin-related protein 6 [Eucalypt... 186 1e-44 ref|XP_002527184.1| conserved hypothetical protein [Ricinus comm... 186 1e-44 ref|XP_004952025.1| PREDICTED: actin-related protein 6 [Setaria ... 184 4e-44 >ref|XP_010241541.1| PREDICTED: actin-related protein 6 isoform X1 [Nelumbo nucifera] Length = 430 Score = 195 bits (495), Expect = 2e-47 Identities = 91/99 (91%), Positives = 96/99 (96%) Frame = -1 Query: 651 IVRAVNSCHPHLHPVLYESIILTGGSTLFPRFAQRLERDLRPLIPDDYQVKITTQEDPIL 472 IVRAVNSCHPHLHPVLYESIILTGGSTLFPRFAQRLE++LRPL+PDDY V+ITTQEDPIL Sbjct: 332 IVRAVNSCHPHLHPVLYESIILTGGSTLFPRFAQRLEKELRPLVPDDYHVQITTQEDPIL 391 Query: 471 GVWRGGSLLASSPDFESTCVTKSEYEEYGSARCRRRFFH 355 GVWRGGSLLASSPDFE+ CVTKSEYEE GSARCRRRFFH Sbjct: 392 GVWRGGSLLASSPDFEAMCVTKSEYEELGSARCRRRFFH 430 >ref|XP_014508589.1| PREDICTED: actin-related protein 6 [Vigna radiata var. radiata] Length = 435 Score = 191 bits (485), Expect = 3e-46 Identities = 88/99 (88%), Positives = 96/99 (96%) Frame = -1 Query: 651 IVRAVNSCHPHLHPVLYESIILTGGSTLFPRFAQRLERDLRPLIPDDYQVKITTQEDPIL 472 IVRAVN+CHPHLHPVLYESIILTGGSTLFP+FA+RLER+LRPL+PDDY V+ITTQEDPIL Sbjct: 337 IVRAVNACHPHLHPVLYESIILTGGSTLFPQFAERLERELRPLVPDDYNVEITTQEDPIL 396 Query: 471 GVWRGGSLLASSPDFESTCVTKSEYEEYGSARCRRRFFH 355 GVWRGGSLLASSPDFE+ CVTKSEYEE GSARCR+RFFH Sbjct: 397 GVWRGGSLLASSPDFEAMCVTKSEYEELGSARCRKRFFH 435 >ref|XP_002285295.1| PREDICTED: actin-related protein 6 [Vitis vinifera] gi|731407281|ref|XP_010656437.1| PREDICTED: actin-related protein 6 [Vitis vinifera] gi|731407283|ref|XP_010656438.1| PREDICTED: actin-related protein 6 [Vitis vinifera] gi|731407285|ref|XP_010656439.1| PREDICTED: actin-related protein 6 [Vitis vinifera] gi|297738970|emb|CBI28215.3| unnamed protein product [Vitis vinifera] Length = 433 Score = 189 bits (481), Expect = 9e-46 Identities = 88/99 (88%), Positives = 95/99 (95%) Frame = -1 Query: 651 IVRAVNSCHPHLHPVLYESIILTGGSTLFPRFAQRLERDLRPLIPDDYQVKITTQEDPIL 472 I+RAVNSCHP LHPVLY+SIILTGGSTLFP+FAQRLE +LRPL+PDDYQVKITTQEDPIL Sbjct: 335 IIRAVNSCHPDLHPVLYQSIILTGGSTLFPQFAQRLEMELRPLVPDDYQVKITTQEDPIL 394 Query: 471 GVWRGGSLLASSPDFESTCVTKSEYEEYGSARCRRRFFH 355 GVWRGGSLLASSPDFE+ CVTKSEYEE GSARCR+RFFH Sbjct: 395 GVWRGGSLLASSPDFEAMCVTKSEYEELGSARCRKRFFH 433 >ref|XP_006450878.1| hypothetical protein CICLE_v10008344mg [Citrus clementina] gi|568843997|ref|XP_006475883.1| PREDICTED: actin-related protein 6-like isoform X1 [Citrus sinensis] gi|568843999|ref|XP_006475884.1| PREDICTED: actin-related protein 6-like isoform X2 [Citrus sinensis] gi|568844001|ref|XP_006475885.1| PREDICTED: actin-related protein 6-like isoform X3 [Citrus sinensis] gi|557554104|gb|ESR64118.1| hypothetical protein CICLE_v10008344mg [Citrus clementina] gi|641861494|gb|KDO80182.1| hypothetical protein CISIN_1g013888mg [Citrus sinensis] Length = 434 Score = 189 bits (481), Expect = 9e-46 Identities = 88/99 (88%), Positives = 96/99 (96%) Frame = -1 Query: 651 IVRAVNSCHPHLHPVLYESIILTGGSTLFPRFAQRLERDLRPLIPDDYQVKITTQEDPIL 472 IVRAVNSCHP+LH VLYESIILTGGSTLFPRFA+RLER+LRPL+PDDYQVKITTQEDP+L Sbjct: 336 IVRAVNSCHPYLHSVLYESIILTGGSTLFPRFAERLERELRPLVPDDYQVKITTQEDPLL 395 Query: 471 GVWRGGSLLASSPDFESTCVTKSEYEEYGSARCRRRFFH 355 GVWRGGSLLASSPDF++ CVTK+EYEE GSARCRRRFFH Sbjct: 396 GVWRGGSLLASSPDFQAMCVTKAEYEENGSARCRRRFFH 434 >ref|XP_012081220.1| PREDICTED: actin-related protein 6 [Jatropha curcas] Length = 431 Score = 189 bits (480), Expect = 1e-45 Identities = 88/99 (88%), Positives = 96/99 (96%) Frame = -1 Query: 651 IVRAVNSCHPHLHPVLYESIILTGGSTLFPRFAQRLERDLRPLIPDDYQVKITTQEDPIL 472 IVRAVNSCHP LHPVLYESIILTGGSTLFP+FA+RLE++LRPL+PD+YQVK+TTQEDPIL Sbjct: 333 IVRAVNSCHPLLHPVLYESIILTGGSTLFPQFAERLEKELRPLVPDEYQVKLTTQEDPIL 392 Query: 471 GVWRGGSLLASSPDFESTCVTKSEYEEYGSARCRRRFFH 355 GVWRGGSLLASSPDFE+ CVTKSEYEE GSARCRRRFFH Sbjct: 393 GVWRGGSLLASSPDFEAMCVTKSEYEELGSARCRRRFFH 431 >gb|KDP30265.1| hypothetical protein JCGZ_17047 [Jatropha curcas] Length = 453 Score = 189 bits (480), Expect = 1e-45 Identities = 88/99 (88%), Positives = 96/99 (96%) Frame = -1 Query: 651 IVRAVNSCHPHLHPVLYESIILTGGSTLFPRFAQRLERDLRPLIPDDYQVKITTQEDPIL 472 IVRAVNSCHP LHPVLYESIILTGGSTLFP+FA+RLE++LRPL+PD+YQVK+TTQEDPIL Sbjct: 355 IVRAVNSCHPLLHPVLYESIILTGGSTLFPQFAERLEKELRPLVPDEYQVKLTTQEDPIL 414 Query: 471 GVWRGGSLLASSPDFESTCVTKSEYEEYGSARCRRRFFH 355 GVWRGGSLLASSPDFE+ CVTKSEYEE GSARCRRRFFH Sbjct: 415 GVWRGGSLLASSPDFEAMCVTKSEYEELGSARCRRRFFH 453 >gb|KHN08098.1| Actin-related protein 6 [Glycine soja] Length = 326 Score = 189 bits (479), Expect = 2e-45 Identities = 87/99 (87%), Positives = 96/99 (96%) Frame = -1 Query: 651 IVRAVNSCHPHLHPVLYESIILTGGSTLFPRFAQRLERDLRPLIPDDYQVKITTQEDPIL 472 IVRAVN+CHPHL PVLYESIILTGGSTLFP+FA+RLE++LRPL+PDDY+VKITTQEDPIL Sbjct: 228 IVRAVNACHPHLRPVLYESIILTGGSTLFPQFAERLEKELRPLVPDDYRVKITTQEDPIL 287 Query: 471 GVWRGGSLLASSPDFESTCVTKSEYEEYGSARCRRRFFH 355 GVWRGGSLLASSPDFE+ CVTKSEYEE GSARCR+RFFH Sbjct: 288 GVWRGGSLLASSPDFEAMCVTKSEYEELGSARCRKRFFH 326 >ref|XP_007153824.1| hypothetical protein PHAVU_003G068000g [Phaseolus vulgaris] gi|561027178|gb|ESW25818.1| hypothetical protein PHAVU_003G068000g [Phaseolus vulgaris] Length = 435 Score = 189 bits (479), Expect = 2e-45 Identities = 86/99 (86%), Positives = 96/99 (96%) Frame = -1 Query: 651 IVRAVNSCHPHLHPVLYESIILTGGSTLFPRFAQRLERDLRPLIPDDYQVKITTQEDPIL 472 IVRAVN+CHPHLHPVLYESIILTGGSTLFP+FA+RLE++LRPL+PDDY V+ITTQEDPIL Sbjct: 337 IVRAVNACHPHLHPVLYESIILTGGSTLFPQFAERLEKELRPLVPDDYNVEITTQEDPIL 396 Query: 471 GVWRGGSLLASSPDFESTCVTKSEYEEYGSARCRRRFFH 355 GVWRGGSLLASSPDFE+ CVTK+EYEE GSARCR+RFFH Sbjct: 397 GVWRGGSLLASSPDFEAMCVTKAEYEELGSARCRKRFFH 435 >ref|XP_003522640.1| PREDICTED: actin-related protein 6-like isoform 1 [Glycine max] gi|214011442|gb|ACJ61471.1| actin-related protein 6 [Glycine max] gi|947113547|gb|KRH61849.1| hypothetical protein GLYMA_04G071500 [Glycine max] Length = 436 Score = 189 bits (479), Expect = 2e-45 Identities = 87/99 (87%), Positives = 96/99 (96%) Frame = -1 Query: 651 IVRAVNSCHPHLHPVLYESIILTGGSTLFPRFAQRLERDLRPLIPDDYQVKITTQEDPIL 472 IVRAVN+CHPHL PVLYESIILTGGSTLFP+FA+RLE++LRPL+PDDY+VKITTQEDPIL Sbjct: 338 IVRAVNACHPHLRPVLYESIILTGGSTLFPQFAERLEKELRPLVPDDYRVKITTQEDPIL 397 Query: 471 GVWRGGSLLASSPDFESTCVTKSEYEEYGSARCRRRFFH 355 GVWRGGSLLASSPDFE+ CVTKSEYEE GSARCR+RFFH Sbjct: 398 GVWRGGSLLASSPDFEAMCVTKSEYEELGSARCRKRFFH 436 >ref|XP_010934377.1| PREDICTED: actin-related protein 6-like isoform X1 [Elaeis guineensis] Length = 433 Score = 188 bits (478), Expect = 2e-45 Identities = 87/98 (88%), Positives = 95/98 (96%) Frame = -1 Query: 651 IVRAVNSCHPHLHPVLYESIILTGGSTLFPRFAQRLERDLRPLIPDDYQVKITTQEDPIL 472 IVRA++SCHPHLHPVL+ESIILTGGSTLFPRFA+RLER+LRPL+PD+YQVKITTQEDPIL Sbjct: 335 IVRAISSCHPHLHPVLFESIILTGGSTLFPRFAERLERELRPLVPDNYQVKITTQEDPIL 394 Query: 471 GVWRGGSLLASSPDFESTCVTKSEYEEYGSARCRRRFF 358 GVWRGGSLLASSPDFES C+TKSEYEE GS RCRRRFF Sbjct: 395 GVWRGGSLLASSPDFESMCITKSEYEEIGSIRCRRRFF 432 >ref|XP_002324643.1| Actin-related family protein [Populus trichocarpa] gi|222866077|gb|EEF03208.1| Actin-related family protein [Populus trichocarpa] Length = 375 Score = 188 bits (478), Expect = 2e-45 Identities = 88/99 (88%), Positives = 95/99 (95%) Frame = -1 Query: 651 IVRAVNSCHPHLHPVLYESIILTGGSTLFPRFAQRLERDLRPLIPDDYQVKITTQEDPIL 472 IVRAVNSCHP LHP+LY+SIILTGGSTLFPRFA+RLE +LRPL+PDDYQVKITTQEDPIL Sbjct: 277 IVRAVNSCHPLLHPLLYQSIILTGGSTLFPRFAERLEMELRPLVPDDYQVKITTQEDPIL 336 Query: 471 GVWRGGSLLASSPDFESTCVTKSEYEEYGSARCRRRFFH 355 GVWRGGSLLASSPDFE+ CVTK+EYEE GSARCRRRFFH Sbjct: 337 GVWRGGSLLASSPDFEAMCVTKAEYEELGSARCRRRFFH 375 >ref|XP_006372160.1| hypothetical protein POPTR_0018s12840g [Populus trichocarpa] gi|118487826|gb|ABK95736.1| unknown [Populus trichocarpa] gi|550318623|gb|ERP49957.1| hypothetical protein POPTR_0018s12840g [Populus trichocarpa] Length = 424 Score = 188 bits (478), Expect = 2e-45 Identities = 88/99 (88%), Positives = 95/99 (95%) Frame = -1 Query: 651 IVRAVNSCHPHLHPVLYESIILTGGSTLFPRFAQRLERDLRPLIPDDYQVKITTQEDPIL 472 IVRAVNSCHP LHP+LY+SIILTGGSTLFPRFA+RLE +LRPL+PDDYQVKITTQEDPIL Sbjct: 326 IVRAVNSCHPLLHPLLYQSIILTGGSTLFPRFAERLEMELRPLVPDDYQVKITTQEDPIL 385 Query: 471 GVWRGGSLLASSPDFESTCVTKSEYEEYGSARCRRRFFH 355 GVWRGGSLLASSPDFE+ CVTK+EYEE GSARCRRRFFH Sbjct: 386 GVWRGGSLLASSPDFEAMCVTKAEYEELGSARCRRRFFH 424 >gb|KOM31459.1| hypothetical protein LR48_Vigan01g101400 [Vigna angularis] Length = 429 Score = 188 bits (477), Expect = 3e-45 Identities = 87/99 (87%), Positives = 95/99 (95%) Frame = -1 Query: 651 IVRAVNSCHPHLHPVLYESIILTGGSTLFPRFAQRLERDLRPLIPDDYQVKITTQEDPIL 472 IVRAVN+CHP LHPVLYESIILTGGSTLFP+FA+RLER+LRPL+PDDY V+ITTQEDPIL Sbjct: 331 IVRAVNACHPQLHPVLYESIILTGGSTLFPQFAERLERELRPLVPDDYNVEITTQEDPIL 390 Query: 471 GVWRGGSLLASSPDFESTCVTKSEYEEYGSARCRRRFFH 355 GVWRGGSLLASSPDFE+ CVTKSEYEE GSARCR+RFFH Sbjct: 391 GVWRGGSLLASSPDFEAMCVTKSEYEELGSARCRKRFFH 429 >ref|XP_007013498.1| Actin related protein isoform 1 [Theobroma cacao] gi|590578394|ref|XP_007013499.1| Actin related protein isoform 1 [Theobroma cacao] gi|508783861|gb|EOY31117.1| Actin related protein isoform 1 [Theobroma cacao] gi|508783862|gb|EOY31118.1| Actin related protein isoform 1 [Theobroma cacao] Length = 435 Score = 188 bits (477), Expect = 3e-45 Identities = 87/99 (87%), Positives = 96/99 (96%) Frame = -1 Query: 651 IVRAVNSCHPHLHPVLYESIILTGGSTLFPRFAQRLERDLRPLIPDDYQVKITTQEDPIL 472 IVRAVN+CHP LHPVL++SIILTGGSTLFPRFA+RLE+DLRPL+PDDYQVKITTQEDPIL Sbjct: 337 IVRAVNACHPCLHPVLFQSIILTGGSTLFPRFAERLEKDLRPLVPDDYQVKITTQEDPIL 396 Query: 471 GVWRGGSLLASSPDFESTCVTKSEYEEYGSARCRRRFFH 355 GVWRGGSLLASSP++ES CVTK+EYEE GSARCRRRFFH Sbjct: 397 GVWRGGSLLASSPEYESMCVTKAEYEELGSARCRRRFFH 435 >ref|XP_011084105.1| PREDICTED: actin-related protein 6 [Sesamum indicum] gi|747074245|ref|XP_011084106.1| PREDICTED: actin-related protein 6 [Sesamum indicum] gi|747074247|ref|XP_011084107.1| PREDICTED: actin-related protein 6 [Sesamum indicum] gi|747074249|ref|XP_011084108.1| PREDICTED: actin-related protein 6 [Sesamum indicum] Length = 433 Score = 187 bits (476), Expect = 4e-45 Identities = 86/99 (86%), Positives = 95/99 (95%) Frame = -1 Query: 651 IVRAVNSCHPHLHPVLYESIILTGGSTLFPRFAQRLERDLRPLIPDDYQVKITTQEDPIL 472 IVR+VNSCHPHLHPVLYESIILTGGSTLFPRFA+RLE++LRPL+PD++QVKIT QEDPIL Sbjct: 335 IVRSVNSCHPHLHPVLYESIILTGGSTLFPRFAERLEKELRPLVPDEFQVKITAQEDPIL 394 Query: 471 GVWRGGSLLASSPDFESTCVTKSEYEEYGSARCRRRFFH 355 GVWRGGSLLASSPDFE+ CVTK+EYEE GSARCRRRF H Sbjct: 395 GVWRGGSLLASSPDFEAMCVTKAEYEELGSARCRRRFLH 433 >ref|XP_009385692.1| PREDICTED: actin-related protein 6 isoform X1 [Musa acuminata subsp. malaccensis] Length = 435 Score = 187 bits (475), Expect = 5e-45 Identities = 87/99 (87%), Positives = 95/99 (95%) Frame = -1 Query: 651 IVRAVNSCHPHLHPVLYESIILTGGSTLFPRFAQRLERDLRPLIPDDYQVKITTQEDPIL 472 IVRAVN+CHP LHPVL+ESIILTGGS+LFPRFA+RLERDLRPL+PDDYQVKIT+QEDPIL Sbjct: 337 IVRAVNACHPLLHPVLFESIILTGGSSLFPRFAERLERDLRPLVPDDYQVKITSQEDPIL 396 Query: 471 GVWRGGSLLASSPDFESTCVTKSEYEEYGSARCRRRFFH 355 GVWRGGSLLASSP+FES C+TKSEYEE GS RCRRRFFH Sbjct: 397 GVWRGGSLLASSPEFESMCITKSEYEEIGSPRCRRRFFH 435 >ref|XP_011017795.1| PREDICTED: actin-related protein 6 [Populus euphratica] gi|743805965|ref|XP_011017796.1| PREDICTED: actin-related protein 6 [Populus euphratica] Length = 424 Score = 187 bits (474), Expect = 6e-45 Identities = 87/99 (87%), Positives = 94/99 (94%) Frame = -1 Query: 651 IVRAVNSCHPHLHPVLYESIILTGGSTLFPRFAQRLERDLRPLIPDDYQVKITTQEDPIL 472 IVRAVNSCHP LHP+LY+SIILTGGSTLFPRFA+RLE +LRPL+PDDYQVKITTQEDPIL Sbjct: 326 IVRAVNSCHPLLHPLLYQSIILTGGSTLFPRFAERLEMELRPLVPDDYQVKITTQEDPIL 385 Query: 471 GVWRGGSLLASSPDFESTCVTKSEYEEYGSARCRRRFFH 355 G WRGGSLLASSPDFE+ CVTK+EYEE GSARCRRRFFH Sbjct: 386 GTWRGGSLLASSPDFEAMCVTKAEYEELGSARCRRRFFH 424 >ref|XP_010050051.1| PREDICTED: actin-related protein 6 [Eucalyptus grandis] gi|629118215|gb|KCW82890.1| hypothetical protein EUGRSUZ_C04260 [Eucalyptus grandis] Length = 448 Score = 186 bits (471), Expect = 1e-44 Identities = 86/97 (88%), Positives = 94/97 (96%) Frame = -1 Query: 651 IVRAVNSCHPHLHPVLYESIILTGGSTLFPRFAQRLERDLRPLIPDDYQVKITTQEDPIL 472 IVRA+NSCHPHLHPVLYESIILTGGSTLFPRFA+RLER+LRPL+PD YQVKITTQ+DPIL Sbjct: 350 IVRAINSCHPHLHPVLYESIILTGGSTLFPRFAERLERELRPLVPDYYQVKITTQQDPIL 409 Query: 471 GVWRGGSLLASSPDFESTCVTKSEYEEYGSARCRRRF 361 GVWRGGSLLASSPDFE+ CVTK++YEE GSARCRRRF Sbjct: 410 GVWRGGSLLASSPDFEAMCVTKADYEELGSARCRRRF 446 >ref|XP_002527184.1| conserved hypothetical protein [Ricinus communis] gi|223533449|gb|EEF35197.1| conserved hypothetical protein [Ricinus communis] Length = 449 Score = 186 bits (471), Expect = 1e-44 Identities = 87/99 (87%), Positives = 94/99 (94%) Frame = -1 Query: 651 IVRAVNSCHPHLHPVLYESIILTGGSTLFPRFAQRLERDLRPLIPDDYQVKITTQEDPIL 472 IVRAVNSCHP LHPVLYESIILTGGSTLFPRF++RL+ +LRPL+PDDYQVKITT EDP+L Sbjct: 351 IVRAVNSCHPLLHPVLYESIILTGGSTLFPRFSERLKMELRPLVPDDYQVKITTLEDPLL 410 Query: 471 GVWRGGSLLASSPDFESTCVTKSEYEEYGSARCRRRFFH 355 GVWRGGSLLASSPDFE+ CVTKSEYEE GSARCRRRFFH Sbjct: 411 GVWRGGSLLASSPDFEAMCVTKSEYEELGSARCRRRFFH 449 >ref|XP_004952025.1| PREDICTED: actin-related protein 6 [Setaria italica] gi|944264661|gb|KQL28901.1| hypothetical protein SETIT_017263mg [Setaria italica] Length = 430 Score = 184 bits (467), Expect = 4e-44 Identities = 86/99 (86%), Positives = 94/99 (94%) Frame = -1 Query: 651 IVRAVNSCHPHLHPVLYESIILTGGSTLFPRFAQRLERDLRPLIPDDYQVKITTQEDPIL 472 IVRAV +CHP+L PVL+ESIILTGGSTLFPRFA+RLER+LRPL+PDDYQVKIT QE+PIL Sbjct: 332 IVRAVQACHPYLQPVLFESIILTGGSTLFPRFAERLERELRPLVPDDYQVKITRQENPIL 391 Query: 471 GVWRGGSLLASSPDFESTCVTKSEYEEYGSARCRRRFFH 355 GVWRGGS+LASSPDFES CVTKSEYEE GSARCRRRFFH Sbjct: 392 GVWRGGSILASSPDFESMCVTKSEYEEMGSARCRRRFFH 430