BLASTX nr result
ID: Papaver30_contig00047326
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver30_contig00047326 (541 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011036701.1| PREDICTED: eukaryotic translation initiation... 44 9e-07 ref|XP_002324920.2| hypothetical protein POPTR_0018s02700g [Popu... 44 9e-07 gb|KHG16321.1| Eukaryotic initiation factor iso-4F subunit p82-3... 43 3e-06 ref|XP_012442299.1| PREDICTED: eukaryotic translation initiation... 43 3e-06 ref|XP_012442300.1| PREDICTED: eukaryotic translation initiation... 43 3e-06 gb|KJB53886.1| hypothetical protein B456_009G009800 [Gossypium r... 43 3e-06 ref|XP_007011702.1| MIF4G domain-containing protein / MA3 domain... 43 4e-06 ref|XP_007011701.1| MIF4G domain-containing protein / MA3 domain... 43 4e-06 gb|KDO67419.1| hypothetical protein CISIN_1g003543mg [Citrus sin... 43 6e-06 ref|XP_006483537.1| PREDICTED: eukaryotic translation initiation... 43 6e-06 gb|KDO67421.1| hypothetical protein CISIN_1g003543mg [Citrus sin... 43 6e-06 gb|KDO67422.1| hypothetical protein CISIN_1g003543mg [Citrus sin... 43 6e-06 ref|XP_008794367.1| PREDICTED: eukaryotic translation initiation... 43 7e-06 ref|XP_011079385.1| PREDICTED: eukaryotic translation initiation... 41 7e-06 ref|XP_011624611.1| PREDICTED: eukaryotic translation initiation... 42 1e-05 ref|XP_010265526.1| PREDICTED: eukaryotic translation initiation... 43 1e-05 ref|XP_002309681.1| hypothetical protein POPTR_0006s28110g [Popu... 40 1e-05 gb|ERM94906.1| hypothetical protein AMTR_s00009p00164690 [Ambore... 42 1e-05 >ref|XP_011036701.1| PREDICTED: eukaryotic translation initiation factor isoform 4G-1-like [Populus euphratica] Length = 768 Score = 44.3 bits (103), Expect(2) = 9e-07 Identities = 24/44 (54%), Positives = 33/44 (75%), Gaps = 5/44 (11%) Frame = +1 Query: 7 TVRKGNLSYKE-----VRSILNKLTVEQYCIVRTQLIDSVITTP 123 +VR+GNLS +E V+ ILNKLT E++ +++ QLIDS ITTP Sbjct: 180 SVRRGNLSEEERVLKTVKGILNKLTPEKFDVLKGQLIDSGITTP 223 Score = 35.0 bits (79), Expect(2) = 9e-07 Identities = 13/28 (46%), Positives = 19/28 (67%) Frame = +2 Query: 128 GITSVIFSKPVTVPAVCPLYAFLCCEVS 211 G+ S+IF K V P CP+YA LC +++ Sbjct: 228 GVISLIFDKAVLEPTFCPMYALLCSDLN 255 >ref|XP_002324920.2| hypothetical protein POPTR_0018s02700g [Populus trichocarpa] gi|550317895|gb|EEF03485.2| hypothetical protein POPTR_0018s02700g [Populus trichocarpa] Length = 750 Score = 44.3 bits (103), Expect(2) = 9e-07 Identities = 24/44 (54%), Positives = 33/44 (75%), Gaps = 5/44 (11%) Frame = +1 Query: 7 TVRKGNLSYKE-----VRSILNKLTVEQYCIVRTQLIDSVITTP 123 +VR+GNLS +E V+ ILNKLT E++ +++ QLIDS ITTP Sbjct: 162 SVRRGNLSEEERVLKTVKGILNKLTPEKFDVLKGQLIDSGITTP 205 Score = 35.0 bits (79), Expect(2) = 9e-07 Identities = 13/28 (46%), Positives = 19/28 (67%) Frame = +2 Query: 128 GITSVIFSKPVTVPAVCPLYAFLCCEVS 211 G+ S+IF K V P CP+YA LC +++ Sbjct: 210 GVISLIFDKAVLEPTFCPMYALLCSDLN 237 >gb|KHG16321.1| Eukaryotic initiation factor iso-4F subunit p82-34 [Gossypium arboreum] Length = 790 Score = 42.7 bits (99), Expect(2) = 3e-06 Identities = 24/43 (55%), Positives = 32/43 (74%), Gaps = 5/43 (11%) Frame = +1 Query: 7 TVRKGNLSYKE-----VRSILNKLTVEQYCIVRTQLIDSVITT 120 +VR+GNLS KE V+ ILNKLT E+Y +++ QLIDS IT+ Sbjct: 205 SVRRGNLSEKERVLKTVKGILNKLTPEKYDLLKGQLIDSGITS 247 Score = 34.7 bits (78), Expect(2) = 3e-06 Identities = 13/28 (46%), Positives = 19/28 (67%) Frame = +2 Query: 128 GITSVIFSKPVTVPAVCPLYAFLCCEVS 211 G+ S+IF K V P CP+YA LC +++ Sbjct: 253 GVISLIFEKAVLEPTFCPMYALLCFDLN 280 >ref|XP_012442299.1| PREDICTED: eukaryotic translation initiation factor isoform 4G-1 isoform X1 [Gossypium raimondii] gi|763786889|gb|KJB53885.1| hypothetical protein B456_009G009800 [Gossypium raimondii] Length = 789 Score = 42.7 bits (99), Expect(2) = 3e-06 Identities = 24/43 (55%), Positives = 32/43 (74%), Gaps = 5/43 (11%) Frame = +1 Query: 7 TVRKGNLSYKE-----VRSILNKLTVEQYCIVRTQLIDSVITT 120 +VR+GNLS KE V+ ILNKLT E+Y +++ QLIDS IT+ Sbjct: 206 SVRRGNLSEKERVLKTVKGILNKLTPEKYDLLKGQLIDSGITS 248 Score = 34.7 bits (78), Expect(2) = 3e-06 Identities = 13/28 (46%), Positives = 19/28 (67%) Frame = +2 Query: 128 GITSVIFSKPVTVPAVCPLYAFLCCEVS 211 G+ S+IF K V P CP+YA LC +++ Sbjct: 254 GVISLIFEKAVLEPTFCPMYALLCFDLN 281 >ref|XP_012442300.1| PREDICTED: eukaryotic translation initiation factor isoform 4G-1 isoform X2 [Gossypium raimondii] Length = 785 Score = 42.7 bits (99), Expect(2) = 3e-06 Identities = 24/43 (55%), Positives = 32/43 (74%), Gaps = 5/43 (11%) Frame = +1 Query: 7 TVRKGNLSYKE-----VRSILNKLTVEQYCIVRTQLIDSVITT 120 +VR+GNLS KE V+ ILNKLT E+Y +++ QLIDS IT+ Sbjct: 202 SVRRGNLSEKERVLKTVKGILNKLTPEKYDLLKGQLIDSGITS 244 Score = 34.7 bits (78), Expect(2) = 3e-06 Identities = 13/28 (46%), Positives = 19/28 (67%) Frame = +2 Query: 128 GITSVIFSKPVTVPAVCPLYAFLCCEVS 211 G+ S+IF K V P CP+YA LC +++ Sbjct: 250 GVISLIFEKAVLEPTFCPMYALLCFDLN 277 >gb|KJB53886.1| hypothetical protein B456_009G009800 [Gossypium raimondii] Length = 766 Score = 42.7 bits (99), Expect(2) = 3e-06 Identities = 24/43 (55%), Positives = 32/43 (74%), Gaps = 5/43 (11%) Frame = +1 Query: 7 TVRKGNLSYKE-----VRSILNKLTVEQYCIVRTQLIDSVITT 120 +VR+GNLS KE V+ ILNKLT E+Y +++ QLIDS IT+ Sbjct: 183 SVRRGNLSEKERVLKTVKGILNKLTPEKYDLLKGQLIDSGITS 225 Score = 34.7 bits (78), Expect(2) = 3e-06 Identities = 13/28 (46%), Positives = 19/28 (67%) Frame = +2 Query: 128 GITSVIFSKPVTVPAVCPLYAFLCCEVS 211 G+ S+IF K V P CP+YA LC +++ Sbjct: 231 GVISLIFEKAVLEPTFCPMYALLCFDLN 258 >ref|XP_007011702.1| MIF4G domain-containing protein / MA3 domain-containing protein isoform 2 [Theobroma cacao] gi|508782065|gb|EOY29321.1| MIF4G domain-containing protein / MA3 domain-containing protein isoform 2 [Theobroma cacao] Length = 822 Score = 42.7 bits (99), Expect(2) = 4e-06 Identities = 23/44 (52%), Positives = 31/44 (70%), Gaps = 5/44 (11%) Frame = +1 Query: 7 TVRKGNLSYKE-----VRSILNKLTVEQYCIVRTQLIDSVITTP 123 + R+GNLS KE + ILNKLT E++ +++ QLIDS ITTP Sbjct: 192 SARRGNLSEKERVLKTAKGILNKLTPEKFDVLKGQLIDSGITTP 235 Score = 34.3 bits (77), Expect(2) = 4e-06 Identities = 12/28 (42%), Positives = 19/28 (67%) Frame = +2 Query: 128 GITSVIFSKPVTVPAVCPLYAFLCCEVS 211 G+ S++F K V P CP+YA LC +++ Sbjct: 240 GVISLLFDKAVLEPTFCPMYALLCSDLN 267 >ref|XP_007011701.1| MIF4G domain-containing protein / MA3 domain-containing protein isoform 1 [Theobroma cacao] gi|508782064|gb|EOY29320.1| MIF4G domain-containing protein / MA3 domain-containing protein isoform 1 [Theobroma cacao] Length = 795 Score = 42.7 bits (99), Expect(2) = 4e-06 Identities = 23/44 (52%), Positives = 31/44 (70%), Gaps = 5/44 (11%) Frame = +1 Query: 7 TVRKGNLSYKE-----VRSILNKLTVEQYCIVRTQLIDSVITTP 123 + R+GNLS KE + ILNKLT E++ +++ QLIDS ITTP Sbjct: 192 SARRGNLSEKERVLKTAKGILNKLTPEKFDVLKGQLIDSGITTP 235 Score = 34.3 bits (77), Expect(2) = 4e-06 Identities = 12/28 (42%), Positives = 19/28 (67%) Frame = +2 Query: 128 GITSVIFSKPVTVPAVCPLYAFLCCEVS 211 G+ S++F K V P CP+YA LC +++ Sbjct: 240 GVISLLFDKAVLEPTFCPMYALLCSDLN 267 >gb|KDO67419.1| hypothetical protein CISIN_1g003543mg [Citrus sinensis] Length = 811 Score = 43.1 bits (100), Expect(2) = 6e-06 Identities = 23/44 (52%), Positives = 32/44 (72%), Gaps = 5/44 (11%) Frame = +1 Query: 7 TVRKGNLSYKE-----VRSILNKLTVEQYCIVRTQLIDSVITTP 123 + R+GNLS K+ V+ ILNKLT E++ +++ QLIDS ITTP Sbjct: 186 SARRGNLSEKDRVLKTVKGILNKLTPEKFDVLKGQLIDSGITTP 229 Score = 33.5 bits (75), Expect(2) = 6e-06 Identities = 12/28 (42%), Positives = 18/28 (64%) Frame = +2 Query: 128 GITSVIFSKPVTVPAVCPLYAFLCCEVS 211 G+ +IF K V P CP+YA LC +++ Sbjct: 268 GVIELIFDKAVLEPTFCPMYALLCSDLN 295 >ref|XP_006483537.1| PREDICTED: eukaryotic translation initiation factor isoform 4G-1-like [Citrus sinensis] gi|641848543|gb|KDO67420.1| hypothetical protein CISIN_1g003543mg [Citrus sinensis] Length = 777 Score = 43.1 bits (100), Expect(2) = 6e-06 Identities = 23/44 (52%), Positives = 32/44 (72%), Gaps = 5/44 (11%) Frame = +1 Query: 7 TVRKGNLSYKE-----VRSILNKLTVEQYCIVRTQLIDSVITTP 123 + R+GNLS K+ V+ ILNKLT E++ +++ QLIDS ITTP Sbjct: 186 SARRGNLSEKDRVLKTVKGILNKLTPEKFDVLKGQLIDSGITTP 229 Score = 33.5 bits (75), Expect(2) = 6e-06 Identities = 12/28 (42%), Positives = 18/28 (64%) Frame = +2 Query: 128 GITSVIFSKPVTVPAVCPLYAFLCCEVS 211 G+ +IF K V P CP+YA LC +++ Sbjct: 234 GVIELIFDKAVLEPTFCPMYALLCSDLN 261 >gb|KDO67421.1| hypothetical protein CISIN_1g003543mg [Citrus sinensis] Length = 776 Score = 43.1 bits (100), Expect(2) = 6e-06 Identities = 23/44 (52%), Positives = 32/44 (72%), Gaps = 5/44 (11%) Frame = +1 Query: 7 TVRKGNLSYKE-----VRSILNKLTVEQYCIVRTQLIDSVITTP 123 + R+GNLS K+ V+ ILNKLT E++ +++ QLIDS ITTP Sbjct: 186 SARRGNLSEKDRVLKTVKGILNKLTPEKFDVLKGQLIDSGITTP 229 Score = 33.5 bits (75), Expect(2) = 6e-06 Identities = 12/28 (42%), Positives = 18/28 (64%) Frame = +2 Query: 128 GITSVIFSKPVTVPAVCPLYAFLCCEVS 211 G+ +IF K V P CP+YA LC +++ Sbjct: 234 GVIELIFDKAVLEPTFCPMYALLCSDLN 261 >gb|KDO67422.1| hypothetical protein CISIN_1g003543mg [Citrus sinensis] gi|641848546|gb|KDO67423.1| hypothetical protein CISIN_1g003543mg [Citrus sinensis] Length = 630 Score = 43.1 bits (100), Expect(2) = 6e-06 Identities = 23/44 (52%), Positives = 32/44 (72%), Gaps = 5/44 (11%) Frame = +1 Query: 7 TVRKGNLSYKE-----VRSILNKLTVEQYCIVRTQLIDSVITTP 123 + R+GNLS K+ V+ ILNKLT E++ +++ QLIDS ITTP Sbjct: 39 SARRGNLSEKDRVLKTVKGILNKLTPEKFDVLKGQLIDSGITTP 82 Score = 33.5 bits (75), Expect(2) = 6e-06 Identities = 12/28 (42%), Positives = 18/28 (64%) Frame = +2 Query: 128 GITSVIFSKPVTVPAVCPLYAFLCCEVS 211 G+ +IF K V P CP+YA LC +++ Sbjct: 87 GVIELIFDKAVLEPTFCPMYALLCSDLN 114 >ref|XP_008794367.1| PREDICTED: eukaryotic translation initiation factor isoform 4G-2-like [Phoenix dactylifera] Length = 817 Score = 43.1 bits (100), Expect(2) = 7e-06 Identities = 23/44 (52%), Positives = 32/44 (72%), Gaps = 5/44 (11%) Frame = +1 Query: 7 TVRKGNLSYKE-----VRSILNKLTVEQYCIVRTQLIDSVITTP 123 + R+GNLS KE V+ ILNKLT E++ +++ QLID+ ITTP Sbjct: 227 SARRGNLSEKEQVLKTVKGILNKLTPEKFDVLKGQLIDAGITTP 270 Score = 33.1 bits (74), Expect(2) = 7e-06 Identities = 12/28 (42%), Positives = 18/28 (64%) Frame = +2 Query: 128 GITSVIFSKPVTVPAVCPLYAFLCCEVS 211 G+ +IF K V P CP+YA LC +++ Sbjct: 275 GVIMLIFEKAVLEPTFCPMYALLCSDLN 302 >ref|XP_011079385.1| PREDICTED: eukaryotic translation initiation factor isoform 4G-1-like [Sesamum indicum] Length = 794 Score = 41.2 bits (95), Expect(2) = 7e-06 Identities = 23/43 (53%), Positives = 31/43 (72%), Gaps = 5/43 (11%) Frame = +1 Query: 7 TVRKGNLSYKE-----VRSILNKLTVEQYCIVRTQLIDSVITT 120 + R+GNLS KE V+ ILNKLT E++ +++ QLIDS ITT Sbjct: 199 SARRGNLSEKERVLKTVKGILNKLTPEKFDLLKGQLIDSGITT 241 Score = 35.0 bits (79), Expect(2) = 7e-06 Identities = 13/28 (46%), Positives = 19/28 (67%) Frame = +2 Query: 128 GITSVIFSKPVTVPAVCPLYAFLCCEVS 211 G+ S+IF K V P CP+YA LC +++ Sbjct: 247 GVISLIFEKAVLEPTFCPMYALLCSDLN 274 >ref|XP_011624611.1| PREDICTED: eukaryotic translation initiation factor isoform 4G-1 [Amborella trichopoda] Length = 820 Score = 42.4 bits (98), Expect(2) = 1e-05 Identities = 23/44 (52%), Positives = 32/44 (72%), Gaps = 5/44 (11%) Frame = +1 Query: 7 TVRKGNLSYKE-----VRSILNKLTVEQYCIVRTQLIDSVITTP 123 + R+GNLS K+ V+ ILNKLT E++ +++ QLIDS ITTP Sbjct: 217 SARRGNLSDKDRVLKTVKGILNKLTPEKFDLLKGQLIDSGITTP 260 Score = 33.5 bits (75), Expect(2) = 1e-05 Identities = 12/28 (42%), Positives = 18/28 (64%) Frame = +2 Query: 128 GITSVIFSKPVTVPAVCPLYAFLCCEVS 211 G+ +IF K V P CP+YA LC +++ Sbjct: 265 GVIDLIFDKAVLEPTFCPMYALLCSDLN 292 >ref|XP_010265526.1| PREDICTED: eukaryotic translation initiation factor isoform 4G-1-like [Nelumbo nucifera] Length = 801 Score = 43.1 bits (100), Expect(2) = 1e-05 Identities = 23/44 (52%), Positives = 32/44 (72%), Gaps = 5/44 (11%) Frame = +1 Query: 7 TVRKGNLSYKE-----VRSILNKLTVEQYCIVRTQLIDSVITTP 123 + R+GNL+ KE V+ ILNKLT E++ +++ QLIDS ITTP Sbjct: 216 SARRGNLTEKERVLKTVKGILNKLTPEKFDVLKGQLIDSGITTP 259 Score = 32.7 bits (73), Expect(2) = 1e-05 Identities = 12/27 (44%), Positives = 18/27 (66%) Frame = +2 Query: 131 ITSVIFSKPVTVPAVCPLYAFLCCEVS 211 + S+IF K V P CP+YA LC +++ Sbjct: 265 VISLIFDKAVLEPTFCPMYALLCSDLN 291 >ref|XP_002309681.1| hypothetical protein POPTR_0006s28110g [Populus trichocarpa] gi|222855657|gb|EEE93204.1| hypothetical protein POPTR_0006s28110g [Populus trichocarpa] Length = 766 Score = 40.4 bits (93), Expect(2) = 1e-05 Identities = 22/44 (50%), Positives = 31/44 (70%), Gaps = 5/44 (11%) Frame = +1 Query: 7 TVRKGNLSYKE-----VRSILNKLTVEQYCIVRTQLIDSVITTP 123 + R+G LS +E V+ ILNKLT E++ +++ QLIDS ITTP Sbjct: 176 SARRGTLSEEERVLKTVKGILNKLTPEKFDVLKGQLIDSGITTP 219 Score = 35.4 bits (80), Expect(2) = 1e-05 Identities = 14/32 (43%), Positives = 20/32 (62%) Frame = +2 Query: 128 GITSVIFSKPVTVPAVCPLYAFLCCEVSVYPH 223 G+ S+IF K V P CP+YA LC +++ H Sbjct: 224 GVISLIFDKAVLEPTFCPMYALLCSDLNEKLH 255 >gb|ERM94906.1| hypothetical protein AMTR_s00009p00164690 [Amborella trichopoda] Length = 634 Score = 42.4 bits (98), Expect(2) = 1e-05 Identities = 23/44 (52%), Positives = 32/44 (72%), Gaps = 5/44 (11%) Frame = +1 Query: 7 TVRKGNLSYKE-----VRSILNKLTVEQYCIVRTQLIDSVITTP 123 + R+GNLS K+ V+ ILNKLT E++ +++ QLIDS ITTP Sbjct: 31 SARRGNLSDKDRVLKTVKGILNKLTPEKFDLLKGQLIDSGITTP 74 Score = 33.5 bits (75), Expect(2) = 1e-05 Identities = 12/28 (42%), Positives = 18/28 (64%) Frame = +2 Query: 128 GITSVIFSKPVTVPAVCPLYAFLCCEVS 211 G+ +IF K V P CP+YA LC +++ Sbjct: 79 GVIDLIFDKAVLEPTFCPMYALLCSDLN 106