BLASTX nr result
ID: Papaver30_contig00046265
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver30_contig00046265 (479 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010094448.1| Putative B3 domain-containing protein [Morus... 67 7e-09 gb|KRH72849.1| hypothetical protein GLYMA_02G237500 [Glycine max... 66 9e-09 gb|KHN41001.1| Putative B3 domain-containing protein [Glycine soja] 66 9e-09 ref|XP_006575462.1| PREDICTED: putative B3 domain-containing pro... 66 9e-09 ref|XP_012568478.1| PREDICTED: neurofilament medium polypeptide-... 65 2e-08 ref|XP_004490734.1| PREDICTED: ankyrin repeat domain-containing ... 65 2e-08 ref|XP_010244587.1| PREDICTED: B3 domain-containing protein Os05... 64 6e-08 ref|XP_014503864.1| PREDICTED: putative B3 domain-containing pro... 63 7e-08 ref|XP_003597798.2| B3 DNA-binding domain protein [Medicago trun... 62 2e-07 ref|XP_007142002.1| hypothetical protein PHAVU_008G244300g [Phas... 60 6e-07 ref|XP_012077831.1| PREDICTED: putative B3 domain-containing pro... 57 4e-06 gb|KDP45675.1| hypothetical protein JCGZ_17282 [Jatropha curcas] 57 4e-06 gb|KDO54936.1| hypothetical protein CISIN_1g039664mg, partial [C... 56 9e-06 ref|XP_006464978.1| PREDICTED: LOW QUALITY PROTEIN: putative B3 ... 56 9e-06 ref|XP_006432041.1| hypothetical protein CICLE_v10003383mg, part... 56 9e-06 >ref|XP_010094448.1| Putative B3 domain-containing protein [Morus notabilis] gi|587866572|gb|EXB56029.1| Putative B3 domain-containing protein [Morus notabilis] Length = 328 Score = 66.6 bits (161), Expect = 7e-09 Identities = 34/59 (57%), Positives = 43/59 (72%) Frame = -1 Query: 338 KGTCDNNFYEEARKQRLEENKKRFEDLGIPKITKTLSEVTKMGQESPVKRQVKPRSRTA 162 K + N YEEARKQRLEENKKRFEDLGI ++K L+E+T ++S + KPRS+TA Sbjct: 5 KSNDNANTYEEARKQRLEENKKRFEDLGIASVSKGLTELTNSEKKSQQGQLPKPRSKTA 63 >gb|KRH72849.1| hypothetical protein GLYMA_02G237500 [Glycine max] gi|947124644|gb|KRH72850.1| hypothetical protein GLYMA_02G237500 [Glycine max] Length = 396 Score = 66.2 bits (160), Expect = 9e-09 Identities = 35/60 (58%), Positives = 44/60 (73%) Frame = -1 Query: 344 MAKGTCDNNFYEEARKQRLEENKKRFEDLGIPKITKTLSEVTKMGQESPVKRQVKPRSRT 165 MAKG C NN YEEARKQRLEENKKRFEDLGI +I+K L+E+ ++ K + P+ +T Sbjct: 1 MAKG-CSNNTYEEARKQRLEENKKRFEDLGISRISKNLTEIASSAKK---KLRHVPKQKT 56 >gb|KHN41001.1| Putative B3 domain-containing protein [Glycine soja] Length = 407 Score = 66.2 bits (160), Expect = 9e-09 Identities = 35/60 (58%), Positives = 44/60 (73%) Frame = -1 Query: 344 MAKGTCDNNFYEEARKQRLEENKKRFEDLGIPKITKTLSEVTKMGQESPVKRQVKPRSRT 165 MAKG C NN YEEARKQRLEENKKRFEDLGI +I+K L+E+ ++ K + P+ +T Sbjct: 1 MAKG-CSNNTYEEARKQRLEENKKRFEDLGISRISKNLTEIASSAKK---KLRHVPKQKT 56 >ref|XP_006575462.1| PREDICTED: putative B3 domain-containing protein At5g58280-like [Glycine max] gi|947124645|gb|KRH72851.1| hypothetical protein GLYMA_02G237500 [Glycine max] gi|947124646|gb|KRH72852.1| hypothetical protein GLYMA_02G237500 [Glycine max] Length = 407 Score = 66.2 bits (160), Expect = 9e-09 Identities = 35/60 (58%), Positives = 44/60 (73%) Frame = -1 Query: 344 MAKGTCDNNFYEEARKQRLEENKKRFEDLGIPKITKTLSEVTKMGQESPVKRQVKPRSRT 165 MAKG C NN YEEARKQRLEENKKRFEDLGI +I+K L+E+ ++ K + P+ +T Sbjct: 1 MAKG-CSNNTYEEARKQRLEENKKRFEDLGISRISKNLTEIASSAKK---KLRHVPKQKT 56 >ref|XP_012568478.1| PREDICTED: neurofilament medium polypeptide-like isoform X2 [Cicer arietinum] Length = 623 Score = 65.1 bits (157), Expect = 2e-08 Identities = 37/60 (61%), Positives = 46/60 (76%) Frame = -1 Query: 344 MAKGTCDNNFYEEARKQRLEENKKRFEDLGIPKITKTLSEVTKMGQESPVKRQVKPRSRT 165 MAKG C+N YEEARK RLEENKKRFEDLGI KI+K L+++ ++SP R +KP S+T Sbjct: 1 MAKG-CNN--YEEARKLRLEENKKRFEDLGISKISKKLTKIKSPAKKSP-SRFLKPNSKT 56 >ref|XP_004490734.1| PREDICTED: ankyrin repeat domain-containing protein 12-like isoform X1 [Cicer arietinum] gi|502096433|ref|XP_004490735.1| PREDICTED: ankyrin repeat domain-containing protein 12-like isoform X1 [Cicer arietinum] Length = 701 Score = 65.1 bits (157), Expect = 2e-08 Identities = 37/60 (61%), Positives = 46/60 (76%) Frame = -1 Query: 344 MAKGTCDNNFYEEARKQRLEENKKRFEDLGIPKITKTLSEVTKMGQESPVKRQVKPRSRT 165 MAKG C+N YEEARK RLEENKKRFEDLGI KI+K L+++ ++SP R +KP S+T Sbjct: 1 MAKG-CNN--YEEARKLRLEENKKRFEDLGISKISKKLTKIKSPAKKSP-SRFLKPNSKT 56 >ref|XP_010244587.1| PREDICTED: B3 domain-containing protein Os05g0481400 [Nelumbo nucifera] Length = 356 Score = 63.5 bits (153), Expect = 6e-08 Identities = 34/59 (57%), Positives = 43/59 (72%) Frame = -1 Query: 344 MAKGTCDNNFYEEARKQRLEENKKRFEDLGIPKITKTLSEVTKMGQESPVKRQVKPRSR 168 MAK + N YEEARKQRL +NKKRFEDLGI KI+K+LSE+ +SP +RQ K + + Sbjct: 1 MAKRSGKINTYEEARKQRLRDNKKRFEDLGILKISKSLSEIASSENKSP-QRQTKAKPK 58 >ref|XP_014503864.1| PREDICTED: putative B3 domain-containing protein At5g58280 [Vigna radiata var. radiata] Length = 399 Score = 63.2 bits (152), Expect = 7e-08 Identities = 33/48 (68%), Positives = 38/48 (79%) Frame = -1 Query: 344 MAKGTCDNNFYEEARKQRLEENKKRFEDLGIPKITKTLSEVTKMGQES 201 MAKG N YEEARKQRLEENKKRFEDLGI KI+K L+E+T ++S Sbjct: 1 MAKGGTINT-YEEARKQRLEENKKRFEDLGISKISKNLTEITSSAKKS 47 >ref|XP_003597798.2| B3 DNA-binding domain protein [Medicago truncatula] gi|657400349|gb|AES68049.2| B3 DNA-binding domain protein [Medicago truncatula] Length = 410 Score = 62.0 bits (149), Expect = 2e-07 Identities = 36/62 (58%), Positives = 45/62 (72%), Gaps = 2/62 (3%) Frame = -1 Query: 344 MAKG--TCDNNFYEEARKQRLEENKKRFEDLGIPKITKTLSEVTKMGQESPVKRQVKPRS 171 MAKG T NN YE AR+QRL ENKKRFEDLGI KI+KTL+E+ ++S R +P+S Sbjct: 1 MAKGCSTTSNN-YEAAREQRLVENKKRFEDLGISKISKTLTEIASPAKKS-TNRLFRPKS 58 Query: 170 RT 165 +T Sbjct: 59 KT 60 >ref|XP_007142002.1| hypothetical protein PHAVU_008G244300g [Phaseolus vulgaris] gi|561015135|gb|ESW13996.1| hypothetical protein PHAVU_008G244300g [Phaseolus vulgaris] Length = 401 Score = 60.1 bits (144), Expect = 6e-07 Identities = 41/91 (45%), Positives = 50/91 (54%), Gaps = 3/91 (3%) Frame = -1 Query: 344 MAKGTCDNNFYEEARKQRLEENKKRFEDLGIPKITKTLSEVTKMGQESPVKRQ---VKPR 174 MAK N YEEARKQRLEENKKRFEDLGI +I+K L+E+T S KRQ KP+ Sbjct: 1 MAKSRTSNT-YEEARKQRLEENKKRFEDLGISRISKNLNEIT----SSAKKRQHHVPKPK 55 Query: 173 SRTAXXXXXXXXXXXXXXSTAVSYEEEYTDH 81 + A SY+E+ + H Sbjct: 56 PKNTNGEVEPRRSSRVRNPVA-SYQEDVSIH 85 >ref|XP_012077831.1| PREDICTED: putative B3 domain-containing protein At5g58280 [Jatropha curcas] gi|802540696|ref|XP_012077836.1| PREDICTED: putative B3 domain-containing protein At5g58280 [Jatropha curcas] Length = 359 Score = 57.4 bits (137), Expect = 4e-06 Identities = 31/58 (53%), Positives = 44/58 (75%) Frame = -1 Query: 344 MAKGTCDNNFYEEARKQRLEENKKRFEDLGIPKITKTLSEVTKMGQESPVKRQVKPRS 171 MA ++N YEEARKQR++ENKKRFEDLGI I+K+LS+++ ++S +R KP+S Sbjct: 1 MAIENGNSNTYEEARKQRVKENKKRFEDLGISNISKSLSKLSSPEKKSK-QRLPKPKS 57 >gb|KDP45675.1| hypothetical protein JCGZ_17282 [Jatropha curcas] Length = 230 Score = 57.4 bits (137), Expect = 4e-06 Identities = 31/58 (53%), Positives = 44/58 (75%) Frame = -1 Query: 344 MAKGTCDNNFYEEARKQRLEENKKRFEDLGIPKITKTLSEVTKMGQESPVKRQVKPRS 171 MA ++N YEEARKQR++ENKKRFEDLGI I+K+LS+++ ++S +R KP+S Sbjct: 1 MAIENGNSNTYEEARKQRVKENKKRFEDLGISNISKSLSKLSSPEKKSK-QRLPKPKS 57 >gb|KDO54936.1| hypothetical protein CISIN_1g039664mg, partial [Citrus sinensis] Length = 214 Score = 56.2 bits (134), Expect = 9e-06 Identities = 26/52 (50%), Positives = 41/52 (78%) Frame = -1 Query: 320 NFYEEARKQRLEENKKRFEDLGIPKITKTLSEVTKMGQESPVKRQVKPRSRT 165 N YEEARK+RLEEN +R ++LGI KI+KTLS+++K ++SP ++ P+ ++ Sbjct: 5 NTYEEARKKRLEENSQRLQELGIEKISKTLSQLSKSVKKSPQAQRHLPKFKS 56 >ref|XP_006464978.1| PREDICTED: LOW QUALITY PROTEIN: putative B3 domain-containing protein At5g58280-like [Citrus sinensis] Length = 427 Score = 56.2 bits (134), Expect = 9e-06 Identities = 26/52 (50%), Positives = 41/52 (78%) Frame = -1 Query: 320 NFYEEARKQRLEENKKRFEDLGIPKITKTLSEVTKMGQESPVKRQVKPRSRT 165 N YEEARK+RLEEN +R ++LGI KI+KTLS+++K ++SP ++ P+ ++ Sbjct: 5 NTYEEARKKRLEENSQRLQELGIEKISKTLSQLSKSVKKSPQAQRHLPKFKS 56 >ref|XP_006432041.1| hypothetical protein CICLE_v10003383mg, partial [Citrus clementina] gi|557534163|gb|ESR45281.1| hypothetical protein CICLE_v10003383mg, partial [Citrus clementina] Length = 81 Score = 56.2 bits (134), Expect = 9e-06 Identities = 26/52 (50%), Positives = 41/52 (78%) Frame = -1 Query: 320 NFYEEARKQRLEENKKRFEDLGIPKITKTLSEVTKMGQESPVKRQVKPRSRT 165 N YEEARK+RLEEN +R ++LGI KI+KTLS+++K ++SP ++ P+ ++ Sbjct: 5 NTYEEARKKRLEENSQRLQELGIEKISKTLSQLSKSVKKSPQAQRHLPKFKS 56