BLASTX nr result
ID: Papaver30_contig00045727
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver30_contig00045727 (438 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010258155.1| PREDICTED: pentatricopeptide repeat-containi... 74 4e-11 ref|XP_002526074.1| pentatricopeptide repeat-containing protein,... 73 9e-11 ref|XP_007032674.1| Pentatricopeptide repeat superfamily protein... 72 2e-10 ref|XP_010936356.1| PREDICTED: pentatricopeptide repeat-containi... 71 3e-10 ref|XP_012084788.1| PREDICTED: pentatricopeptide repeat-containi... 71 4e-10 gb|KOM36655.1| hypothetical protein LR48_Vigan03g003600 [Vigna a... 68 2e-09 ref|XP_011098709.1| PREDICTED: pentatricopeptide repeat-containi... 68 2e-09 ref|XP_008230319.1| PREDICTED: pentatricopeptide repeat-containi... 68 2e-09 ref|XP_010661121.1| PREDICTED: pentatricopeptide repeat-containi... 68 3e-09 ref|XP_006482700.1| PREDICTED: pentatricopeptide repeat-containi... 67 4e-09 ref|XP_009378291.1| PREDICTED: pentatricopeptide repeat-containi... 67 7e-09 ref|XP_012483526.1| PREDICTED: pentatricopeptide repeat-containi... 66 1e-08 ref|XP_012483527.1| PREDICTED: pentatricopeptide repeat-containi... 66 1e-08 ref|XP_012851374.1| PREDICTED: pentatricopeptide repeat-containi... 65 1e-08 ref|XP_008792753.1| PREDICTED: pentatricopeptide repeat-containi... 65 1e-08 ref|XP_014498292.1| PREDICTED: pentatricopeptide repeat-containi... 65 3e-08 ref|XP_014498291.1| PREDICTED: pentatricopeptide repeat-containi... 65 3e-08 gb|KDO72674.1| hypothetical protein CISIN_1g007701mg [Citrus sin... 64 3e-08 ref|XP_006431232.1| hypothetical protein CICLE_v10011344mg [Citr... 64 3e-08 gb|KHN13778.1| Pentatricopeptide repeat-containing protein [Glyc... 64 4e-08 >ref|XP_010258155.1| PREDICTED: pentatricopeptide repeat-containing protein At3g29290 [Nelumbo nucifera] Length = 618 Score = 73.9 bits (180), Expect = 4e-11 Identities = 41/81 (50%), Positives = 52/81 (64%), Gaps = 8/81 (9%) Frame = -2 Query: 221 VPPWGNLDERLESKIDSVPSNSGRVSCV--------LEPRLHFLEERDEEVLSNRILNLS 66 +PPWGN +S V + GR + + +P+LHFLEE DEEVLS RIL+LS Sbjct: 128 LPPWGNSTVHDDS---GVAHSGGRPTSIESKVMVSPFQPKLHFLEEMDEEVLSKRILSLS 184 Query: 65 RTNKVNSAFDLYMSMEVSGLQ 3 R+NK SA +LYMSME SGL+ Sbjct: 185 RSNKFRSALELYMSMEASGLR 205 >ref|XP_002526074.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223534571|gb|EEF36268.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 285 Score = 72.8 bits (177), Expect = 9e-11 Identities = 45/102 (44%), Positives = 61/102 (59%), Gaps = 5/102 (4%) Frame = -2 Query: 293 EENNNQMLFRNDERNVGRRDEKFLVPPWGNLDERLESKIDSV----PSNSGRVSCVL-EP 129 EEN Q + ++ + + + +PPWGNL E ++D PS S R + L E Sbjct: 21 EENEEQEVIQSRKDELDMDSFEKYLPPWGNLTVHQEPELDPAGIVQPSISPRNTISLDES 80 Query: 128 RLHFLEERDEEVLSNRILNLSRTNKVNSAFDLYMSMEVSGLQ 3 R+H LEE +EE LS RIL LSR+NKV SA +L+ SME SGL+ Sbjct: 81 RVHLLEEGNEEELSRRILMLSRSNKVRSALELFRSMEFSGLR 122 >ref|XP_007032674.1| Pentatricopeptide repeat superfamily protein, putative isoform 1 [Theobroma cacao] gi|590650578|ref|XP_007032675.1| Pentatricopeptide repeat superfamily protein, putative isoform 1 [Theobroma cacao] gi|508711703|gb|EOY03600.1| Pentatricopeptide repeat superfamily protein, putative isoform 1 [Theobroma cacao] gi|508711704|gb|EOY03601.1| Pentatricopeptide repeat superfamily protein, putative isoform 1 [Theobroma cacao] Length = 619 Score = 72.0 bits (175), Expect = 2e-10 Identities = 49/110 (44%), Positives = 68/110 (61%), Gaps = 6/110 (5%) Frame = -2 Query: 314 EHELVDDEENNNQMLFRNDERNVGRRDEKFLVPPWGNL--DERLESKIDSVP----SNSG 153 E + DDEEN +L + + G +PPWGNL DE L+ + SV S++G Sbjct: 104 EMDCEDDEEN---ILIQKGKEEFGLDSLGQNLPPWGNLVVDESLDFEHTSVGQPAISSNG 160 Query: 152 RVSCVLEPRLHFLEERDEEVLSNRILNLSRTNKVNSAFDLYMSMEVSGLQ 3 + S V + ++HFLEE +EE LS R+L LSR+NKV SA +L SM++SGLQ Sbjct: 161 KDS-VHDSKVHFLEETNEEELSRRVLMLSRSNKVRSALELCRSMKLSGLQ 209 >ref|XP_010936356.1| PREDICTED: pentatricopeptide repeat-containing protein At3g29290 [Elaeis guineensis] gi|743837303|ref|XP_010936357.1| PREDICTED: pentatricopeptide repeat-containing protein At3g29290 [Elaeis guineensis] Length = 605 Score = 71.2 bits (173), Expect = 3e-10 Identities = 52/120 (43%), Positives = 70/120 (58%), Gaps = 4/120 (3%) Frame = -2 Query: 350 RKKVNRVVLSHLEHELVDDEENNNQMLFRNDERNVGRRDEKFLVPPWGN--LDERLESKI 177 R++ N V S + LV ++E + M N E + + + PP+ + E L + Sbjct: 86 RRRDNLVTFSSFKAGLVYEKEAS--MSPWNQENQFIADNNEDMQPPFVTPVVPEELIIEP 143 Query: 176 DSVPS--NSGRVSCVLEPRLHFLEERDEEVLSNRILNLSRTNKVNSAFDLYMSMEVSGLQ 3 S PS NS R + E +LH+LEERDEE LS RIL+LSR+NK SA +LY SMEVSGLQ Sbjct: 144 RSGPSSTNSAREHHLSEVKLHYLEERDEETLSKRILSLSRSNKGRSALELYTSMEVSGLQ 203 >ref|XP_012084788.1| PREDICTED: pentatricopeptide repeat-containing protein At3g29290 [Jatropha curcas] gi|802715703|ref|XP_012084789.1| PREDICTED: pentatricopeptide repeat-containing protein At3g29290 [Jatropha curcas] gi|643714856|gb|KDP27211.1| hypothetical protein JCGZ_19910 [Jatropha curcas] Length = 655 Score = 70.9 bits (172), Expect = 4e-10 Identities = 49/124 (39%), Positives = 68/124 (54%), Gaps = 11/124 (8%) Frame = -2 Query: 341 VNRVVLSHLEHELVDDEENNNQMLFRNDERNVGRRDEKFLVPPWGNLDERLESKIDSVPS 162 V+ +V S+ ++ LV +E N +M+ R E N +E PPWGNL L ++D P Sbjct: 106 VSNLVASN-DYGLVSEENENKEMIQRGHEVNTDCYEE--YAPPWGNL--MLYGELDMDPE 160 Query: 161 ----------NSGRVSCVLEP-RLHFLEERDEEVLSNRILNLSRTNKVNSAFDLYMSMEV 15 N R ++ R+H LEE D E LS RIL LSR+NKV SA +L+ SME Sbjct: 161 SIIQPSVASRNDSRNKVTIDDTRVHLLEETDGEELSRRILMLSRSNKVKSAIELFRSMEF 220 Query: 14 SGLQ 3 SG++ Sbjct: 221 SGIR 224 >gb|KOM36655.1| hypothetical protein LR48_Vigan03g003600 [Vigna angularis] Length = 783 Score = 68.2 bits (165), Expect = 2e-09 Identities = 42/101 (41%), Positives = 60/101 (59%), Gaps = 3/101 (2%) Frame = -2 Query: 299 DDEENNNQMLFRNDERNVGRRDEKFLVPPWGNLDE--RLESK-IDSVPSNSGRVSCVLEP 129 D+ +NN N + +G + E + PWG D+ L S+ +++ S S R ++E Sbjct: 285 DNAVSNNAERRANGDVYIGAKKE---LAPWGEADDGGHLYSRHVETTLSASERTGLIMEQ 341 Query: 128 RLHFLEERDEEVLSNRILNLSRTNKVNSAFDLYMSMEVSGL 6 FLEE DE VLSNRI+ LSRTNK+ SA + + SME+SGL Sbjct: 342 GAIFLEEMDENVLSNRIVVLSRTNKIRSAMEYFRSMELSGL 382 >ref|XP_011098709.1| PREDICTED: pentatricopeptide repeat-containing protein At3g29290 [Sesamum indicum] Length = 611 Score = 68.2 bits (165), Expect = 2e-09 Identities = 48/124 (38%), Positives = 63/124 (50%), Gaps = 3/124 (2%) Frame = -2 Query: 368 KMSCIGRKKVNRVVLSHLEHELVDDEENNNQMLFRNDERNVGRRDEKFLVPPWGNL-DER 192 K CI KV R+ E D + LF E + ++PPWG+L DE Sbjct: 97 KTPCIMPNKVARL-------EFESDCDEGRTPLFEGKE-GFSENCPQHILPPWGDLSDEE 148 Query: 191 LE--SKIDSVPSNSGRVSCVLEPRLHFLEERDEEVLSNRILNLSRTNKVNSAFDLYMSME 18 LE + +D S + + ++LEER+EE+LS RIL LSR+NKV S LY SME Sbjct: 149 LEYQNNLDDSLRRSTKTIDETDNERYYLEERNEEILSKRILKLSRSNKVRSVLALYRSME 208 Query: 17 VSGL 6 SGL Sbjct: 209 FSGL 212 >ref|XP_008230319.1| PREDICTED: pentatricopeptide repeat-containing protein At3g29290 [Prunus mume] Length = 602 Score = 68.2 bits (165), Expect = 2e-09 Identities = 46/113 (40%), Positives = 66/113 (58%), Gaps = 5/113 (4%) Frame = -2 Query: 329 VLSHLEHELVDDEENNNQMLFRNDERNVGRRDEKFLVPPWGNL----DERLESKIDSVPS 162 +++ ++ LV +EE ++M+ R E K +PPWG L D +E ++ P Sbjct: 72 MVAGVQSGLVCEEEEEDKMVQR--EGGYETSFVKQALPPWGELAIDEDLDIEPEVPIQPE 129 Query: 161 NS-GRVSCVLEPRLHFLEERDEEVLSNRILNLSRTNKVNSAFDLYMSMEVSGL 6 + R + + E R+ FLEE DEE LS RIL LSRTNK SA +L+ SME+SGL Sbjct: 130 SCLKRKASLNENRVSFLEEMDEETLSKRILVLSRTNKTRSALELFTSMELSGL 182 >ref|XP_010661121.1| PREDICTED: pentatricopeptide repeat-containing protein At3g29290 [Vitis vinifera] gi|731419726|ref|XP_002279015.2| PREDICTED: pentatricopeptide repeat-containing protein At3g29290 [Vitis vinifera] gi|296082982|emb|CBI22283.3| unnamed protein product [Vitis vinifera] Length = 626 Score = 67.8 bits (164), Expect = 3e-09 Identities = 45/105 (42%), Positives = 62/105 (59%), Gaps = 6/105 (5%) Frame = -2 Query: 299 DDEENN-NQMLFRNDERNVGRRDEKFLVPPWGNLDERLESKIDSVP-----SNSGRVSCV 138 +DEEN NQ R +E + ++KF PP GN + + + + S +S Sbjct: 113 EDEENMLNQR--RKEEFDPSYFEQKF--PPLGNSEIHKNPDFEHIGVAEPLTISTGISSE 168 Query: 137 LEPRLHFLEERDEEVLSNRILNLSRTNKVNSAFDLYMSMEVSGLQ 3 E +LHFLEER+E++LS RIL LSR+NKV S +LY +ME SGLQ Sbjct: 169 FEDKLHFLEERNEQILSKRILMLSRSNKVRSVLELYRTMEFSGLQ 213 >ref|XP_006482700.1| PREDICTED: pentatricopeptide repeat-containing protein At3g29290-like [Citrus sinensis] Length = 592 Score = 67.4 bits (163), Expect = 4e-09 Identities = 43/99 (43%), Positives = 61/99 (61%), Gaps = 14/99 (14%) Frame = -2 Query: 257 ERNVGRRDEKFL--------VPPWGNL-----DERLESKIDSVP-SNSGRVSCVLEPRLH 120 E ++ R E+FL +PPWGN+ +E K + P + SG+++ E R+ Sbjct: 95 ENHLIERREEFLDLDFVGSNLPPWGNVVVQQGGSDVEVKSGNQPLAVSGKMAFGSEIRVQ 154 Query: 119 FLEERDEEVLSNRILNLSRTNKVNSAFDLYMSMEVSGLQ 3 FLEE +EE+LS R+L LSR+NKV SA +LY SM+ SGLQ Sbjct: 155 FLEEANEEILSRRVLMLSRSNKVRSALELYESMKCSGLQ 193 >ref|XP_009378291.1| PREDICTED: pentatricopeptide repeat-containing protein At3g29290 [Pyrus x bretschneideri] Length = 596 Score = 66.6 bits (161), Expect = 7e-09 Identities = 45/119 (37%), Positives = 67/119 (56%), Gaps = 11/119 (9%) Frame = -2 Query: 329 VLSHLEHELVDDEENNNQMLFRNDERNVGRRDEKFLV----PPWGNLDERLESKIDSVP- 165 +++ ++ LV +EE ++++ RN G D+ V PPWG L+ + +D P Sbjct: 65 MVAGVQSGLVCEEEEEDKLI-----RNRGYGDDAAFVKQKLPPWGELE--FDKDLDVEPE 117 Query: 164 ------SNSGRVSCVLEPRLHFLEERDEEVLSNRILNLSRTNKVNSAFDLYMSMEVSGL 6 SN R + + R+ +LEE DEE LS RIL LSRTNK SA +L+ SME++GL Sbjct: 118 VVIQPESNLNRKATLNVDRVGYLEEMDEETLSKRILVLSRTNKTRSALELFTSMELAGL 176 >ref|XP_012483526.1| PREDICTED: pentatricopeptide repeat-containing protein At3g29290 isoform X1 [Gossypium raimondii] Length = 576 Score = 65.9 bits (159), Expect = 1e-08 Identities = 38/72 (52%), Positives = 49/72 (68%), Gaps = 4/72 (5%) Frame = -2 Query: 206 NLDERLESKIDS---VPSNSGR-VSCVLEPRLHFLEERDEEVLSNRILNLSRTNKVNSAF 39 N+ ES++DS +PS S V + ++HFLEER+EE LS RIL LSR+NKV SA Sbjct: 99 NMTASFESELDSSRNLPSTSSNGKDLVYDSKVHFLEERNEEELSRRILMLSRSNKVRSAL 158 Query: 38 DLYMSMEVSGLQ 3 +LY SME SGL+ Sbjct: 159 ELYKSMEFSGLK 170 >ref|XP_012483527.1| PREDICTED: pentatricopeptide repeat-containing protein At3g29290 isoform X2 [Gossypium raimondii] gi|763766249|gb|KJB33464.1| hypothetical protein B456_006G011900 [Gossypium raimondii] Length = 516 Score = 65.9 bits (159), Expect = 1e-08 Identities = 38/72 (52%), Positives = 49/72 (68%), Gaps = 4/72 (5%) Frame = -2 Query: 206 NLDERLESKIDS---VPSNSGR-VSCVLEPRLHFLEERDEEVLSNRILNLSRTNKVNSAF 39 N+ ES++DS +PS S V + ++HFLEER+EE LS RIL LSR+NKV SA Sbjct: 39 NMTASFESELDSSRNLPSTSSNGKDLVYDSKVHFLEERNEEELSRRILMLSRSNKVRSAL 98 Query: 38 DLYMSMEVSGLQ 3 +LY SME SGL+ Sbjct: 99 ELYKSMEFSGLK 110 >ref|XP_012851374.1| PREDICTED: pentatricopeptide repeat-containing protein At3g29290 [Erythranthe guttatus] Length = 572 Score = 65.5 bits (158), Expect = 1e-08 Identities = 38/75 (50%), Positives = 47/75 (62%), Gaps = 4/75 (5%) Frame = -2 Query: 218 PPWGNL---DERLESKIDSVPSNSGRVSC-VLEPRLHFLEERDEEVLSNRILNLSRTNKV 51 PPWGNL D + S P S + + +++LEERDEE+LSNR+LNLSR+NKV Sbjct: 99 PPWGNLSNQDSEDRNHFISRPKVSSKNTFDESSNEMYYLEERDEEILSNRLLNLSRSNKV 158 Query: 50 NSAFDLYMSMEVSGL 6 SA LY SME S L Sbjct: 159 RSALSLYRSMEFSDL 173 >ref|XP_008792753.1| PREDICTED: pentatricopeptide repeat-containing protein At3g29290 [Phoenix dactylifera] Length = 607 Score = 65.5 bits (158), Expect = 1e-08 Identities = 37/69 (53%), Positives = 49/69 (71%), Gaps = 2/69 (2%) Frame = -2 Query: 203 LDERLESKIDSVPSN--SGRVSCVLEPRLHFLEERDEEVLSNRILNLSRTNKVNSAFDLY 30 + E L ++ + PS+ S R + E +LH+L+ER EE LS RIL+LSR+NKV SA +LY Sbjct: 137 IPEELIIELRNRPSSASSEREHILSEVKLHYLDERGEETLSKRILSLSRSNKVRSALELY 196 Query: 29 MSMEVSGLQ 3 SMEVSGLQ Sbjct: 197 ASMEVSGLQ 205 >ref|XP_014498292.1| PREDICTED: pentatricopeptide repeat-containing protein At3g29290 isoform X2 [Vigna radiata var. radiata] Length = 788 Score = 64.7 bits (156), Expect = 3e-08 Identities = 41/101 (40%), Positives = 59/101 (58%), Gaps = 3/101 (2%) Frame = -2 Query: 299 DDEENNNQMLFRNDERNVGRRDEKFLVPPWGNLDE--RLESK-IDSVPSNSGRVSCVLEP 129 D+ +NN N + +G + E + PWG D+ L S+ +++ S S ++E Sbjct: 291 DNVFSNNAERRANGDVYIGAKKE---LAPWGEADDGGHLYSRHVETTLSASEGTGLIMEQ 347 Query: 128 RLHFLEERDEEVLSNRILNLSRTNKVNSAFDLYMSMEVSGL 6 FLEE DE VLSNRI+ LSRTNK+ SA + + SME+SGL Sbjct: 348 GAIFLEEMDENVLSNRIVVLSRTNKIRSAMEYFRSMELSGL 388 >ref|XP_014498291.1| PREDICTED: pentatricopeptide repeat-containing protein At3g29290 isoform X1 [Vigna radiata var. radiata] Length = 789 Score = 64.7 bits (156), Expect = 3e-08 Identities = 41/101 (40%), Positives = 59/101 (58%), Gaps = 3/101 (2%) Frame = -2 Query: 299 DDEENNNQMLFRNDERNVGRRDEKFLVPPWGNLDE--RLESK-IDSVPSNSGRVSCVLEP 129 D+ +NN N + +G + E + PWG D+ L S+ +++ S S ++E Sbjct: 291 DNVFSNNAERRANGDVYIGAKKE---LAPWGEADDGGHLYSRHVETTLSASEGTGLIMEQ 347 Query: 128 RLHFLEERDEEVLSNRILNLSRTNKVNSAFDLYMSMEVSGL 6 FLEE DE VLSNRI+ LSRTNK+ SA + + SME+SGL Sbjct: 348 GAIFLEEMDENVLSNRIVVLSRTNKIRSAMEYFRSMELSGL 388 >gb|KDO72674.1| hypothetical protein CISIN_1g007701mg [Citrus sinensis] Length = 592 Score = 64.3 bits (155), Expect = 3e-08 Identities = 43/118 (36%), Positives = 68/118 (57%), Gaps = 9/118 (7%) Frame = -2 Query: 329 VLSHLEHELVDDEENNNQMLFRNDERNVGRRDEKFL---VPPWGNL-----DERLESKID 174 +++ +E ++ N ++ R +E D F+ +PPWGN+ +E K Sbjct: 80 IVASIEPVTTSEDVRENHLIERREEL----LDLDFVGSNLPPWGNVVVQQGGSDVEVKSG 135 Query: 173 SVP-SNSGRVSCVLEPRLHFLEERDEEVLSNRILNLSRTNKVNSAFDLYMSMEVSGLQ 3 + P + S +++ E R+ FLEE +EE+LS R+L LSR+NKV SA +LY SM+ SGLQ Sbjct: 136 NQPLAVSRKMAFGSEIRVQFLEEANEEILSRRVLMLSRSNKVRSALELYESMKCSGLQ 193 >ref|XP_006431232.1| hypothetical protein CICLE_v10011344mg [Citrus clementina] gi|557533289|gb|ESR44472.1| hypothetical protein CICLE_v10011344mg [Citrus clementina] Length = 591 Score = 64.3 bits (155), Expect = 3e-08 Identities = 43/118 (36%), Positives = 68/118 (57%), Gaps = 9/118 (7%) Frame = -2 Query: 329 VLSHLEHELVDDEENNNQMLFRNDERNVGRRDEKFL---VPPWGNL-----DERLESKID 174 +++ +E ++ N ++ R +E D F+ +PPWGN+ +E K Sbjct: 79 IVASIEPVTTSEDVRENHLIERREEL----LDLDFVGSNLPPWGNVVVQQGGSDVEVKSG 134 Query: 173 SVP-SNSGRVSCVLEPRLHFLEERDEEVLSNRILNLSRTNKVNSAFDLYMSMEVSGLQ 3 + P + S +++ E R+ FLEE +EE+LS R+L LSR+NKV SA +LY SM+ SGLQ Sbjct: 135 NQPLAVSRKMAFGSEIRVQFLEEANEEILSRRVLMLSRSNKVRSALELYESMKCSGLQ 192 >gb|KHN13778.1| Pentatricopeptide repeat-containing protein [Glycine soja] Length = 749 Score = 63.9 bits (154), Expect = 4e-08 Identities = 41/110 (37%), Positives = 61/110 (55%), Gaps = 3/110 (2%) Frame = -2 Query: 326 LSHLEHELVDDEENNNQMLFRNDERNVGRRDEKFLVPPWGNLDE---RLESKIDSVPSNS 156 L +E + D+ +N+ N + G + E +PPWG ++ R +++ S Sbjct: 242 LGEVEDDDDHDDFDNSVERRANGDVYFGAKKE---LPPWGGAEDDGHRDSRPVETTSSAP 298 Query: 155 GRVSCVLEPRLHFLEERDEEVLSNRILNLSRTNKVNSAFDLYMSMEVSGL 6 + + E + FLEE DE VLSNRIL LSRTNK+ SA + + SME+SGL Sbjct: 299 QGIGLLNEHGVLFLEELDENVLSNRILVLSRTNKIRSAMEYFRSMELSGL 348