BLASTX nr result
ID: Papaver30_contig00044948
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver30_contig00044948 (653 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010099542.1| hypothetical protein L484_011615 [Morus nota... 57 7e-06 >ref|XP_010099542.1| hypothetical protein L484_011615 [Morus notabilis] gi|587890781|gb|EXB79422.1| hypothetical protein L484_011615 [Morus notabilis] Length = 214 Score = 57.4 bits (137), Expect = 7e-06 Identities = 39/105 (37%), Positives = 53/105 (50%), Gaps = 16/105 (15%) Frame = -2 Query: 424 DELIDRSMTKYLKEAKTGKLD------------IQVMASNGYRLLLYQSVP*TLTHS*WP 281 +ELIDR+++ +L++ + G + I +A N Y L+ Sbjct: 102 EELIDRTISNFLQQVEEGSWESGGWPQTFTDYSISKLAVNAYTRLM-------------A 148 Query: 280 RVLSNRPECQI----CCCLGWVKTAMEGCAGSSLADEGADKGFGL 158 R+LSNRPE Q C C GWVKTAM G AG+ A+EGAD G L Sbjct: 149 RILSNRPEGQKIYINCYCPGWVKTAMTGYAGNIPAEEGADTGVWL 193