BLASTX nr result
ID: Papaver30_contig00044647
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver30_contig00044647 (560 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_008222779.1| PREDICTED: F-box protein At3g07870-like [Pru... 62 1e-07 >ref|XP_008222779.1| PREDICTED: F-box protein At3g07870-like [Prunus mume] Length = 403 Score = 62.4 bits (150), Expect = 1e-07 Identities = 33/94 (35%), Positives = 53/94 (56%), Gaps = 3/94 (3%) Frame = -1 Query: 380 LVGFCNGLACVHRIRASNDTYALITVANLIRSESVVLSYSPPTVGYINLGHGSGFDPLSQ 201 +V CNGL C +++ + N Y + ++N I ES+ L SPP IN G GF P+S Sbjct: 120 IVSSCNGLLCFYKVDSWNPPYGRLYISNPITGESLALP-SPPDEYEINFPSGFGFSPMSG 178 Query: 200 AYKVVILFVSKANDE---FLCMVTTLGTNSWRKI 108 AYK+V+ D+ + +V T+G+ +WR++ Sbjct: 179 AYKLVLFRPKSGWDDEPYLVVLVLTVGSGAWRRL 212