BLASTX nr result
ID: Papaver30_contig00043589
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver30_contig00043589 (1187 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006842741.2| PREDICTED: HIPL1 protein [Amborella trichopoda] 46 8e-06 gb|ERN04416.1| hypothetical protein AMTR_s00133p00052350 [Ambore... 46 8e-06 >ref|XP_006842741.2| PREDICTED: HIPL1 protein [Amborella trichopoda] Length = 724 Score = 46.2 bits (108), Expect(2) = 8e-06 Identities = 21/44 (47%), Positives = 26/44 (59%) Frame = -1 Query: 878 MSGKEELNSLRILGYYSIPTFSQHMLDKDSLPDIWALGSSNPWR 747 M E++ LR+ G YSIP + D S P+IWALG NPWR Sbjct: 453 MPSATEIDDLRLWGNYSIPKDNPFSQDNKSQPEIWALGLRNPWR 496 Score = 32.3 bits (72), Expect(2) = 8e-06 Identities = 14/24 (58%), Positives = 17/24 (70%) Frame = -2 Query: 745 CSLDLQKPSYFLCVDPAKVGS*FY 674 CS DL++PSYF+C D VG FY Sbjct: 497 CSFDLERPSYFVCAD---VGQEFY 517 >gb|ERN04416.1| hypothetical protein AMTR_s00133p00052350 [Amborella trichopoda] Length = 706 Score = 46.2 bits (108), Expect(2) = 8e-06 Identities = 21/44 (47%), Positives = 26/44 (59%) Frame = -1 Query: 878 MSGKEELNSLRILGYYSIPTFSQHMLDKDSLPDIWALGSSNPWR 747 M E++ LR+ G YSIP + D S P+IWALG NPWR Sbjct: 435 MPSATEIDDLRLWGNYSIPKDNPFSQDNKSQPEIWALGLRNPWR 478 Score = 32.3 bits (72), Expect(2) = 8e-06 Identities = 14/24 (58%), Positives = 17/24 (70%) Frame = -2 Query: 745 CSLDLQKPSYFLCVDPAKVGS*FY 674 CS DL++PSYF+C D VG FY Sbjct: 479 CSFDLERPSYFVCAD---VGQEFY 499