BLASTX nr result
ID: Papaver30_contig00041360
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver30_contig00041360 (478 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010664514.1| PREDICTED: DNA excision repair protein ERCC-... 59 2e-06 >ref|XP_010664514.1| PREDICTED: DNA excision repair protein ERCC-8 [Vitis vinifera] gi|302142198|emb|CBI19401.3| unnamed protein product [Vitis vinifera] Length = 458 Score = 58.5 bits (140), Expect = 2e-06 Identities = 27/43 (62%), Positives = 30/43 (69%), Gaps = 4/43 (9%) Frame = -3 Query: 476 EMYTGSNDRQILVWSPPKIRLDEMDGGGNSE----QDQDCWSD 360 E+YTG NDRQILVWSP ++ DEMD G E QDQD WSD Sbjct: 416 ELYTGGNDRQILVWSPSRLNFDEMDHGSREEPIHAQDQDNWSD 458