BLASTX nr result
ID: Papaver30_contig00039317
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver30_contig00039317 (400 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010277321.1| PREDICTED: rhodanese-like domain-containing ... 99 1e-18 ref|XP_010277319.1| PREDICTED: rhodanese-like domain-containing ... 99 1e-18 ref|XP_010663927.1| PREDICTED: rhodanese-like domain-containing ... 98 2e-18 ref|XP_002264379.2| PREDICTED: rhodanese-like domain-containing ... 98 2e-18 ref|XP_011086965.1| PREDICTED: rhodanese-like domain-containing ... 98 3e-18 ref|XP_004252197.1| PREDICTED: rhodanese-like domain-containing ... 97 5e-18 ref|XP_006345730.1| PREDICTED: rhodanese-like domain-containing ... 96 1e-17 ref|XP_012829280.1| PREDICTED: rhodanese-like domain-containing ... 94 3e-17 ref|XP_011047775.1| PREDICTED: rhodanese-like domain-containing ... 94 3e-17 gb|EYU17793.1| hypothetical protein MIMGU_mgv1a006537mg [Erythra... 94 3e-17 ref|XP_006374262.1| hypothetical protein POPTR_0015s05490g [Popu... 94 3e-17 emb|CDO98592.1| unnamed protein product [Coffea canephora] 94 5e-17 gb|KHG14248.1| hypothetical protein F383_17325 [Gossypium arboreum] 93 7e-17 ref|XP_009594000.1| PREDICTED: rhodanese-like domain-containing ... 93 7e-17 ref|XP_012469270.1| PREDICTED: rhodanese-like domain-containing ... 93 9e-17 ref|XP_012469262.1| PREDICTED: rhodanese-like domain-containing ... 93 9e-17 ref|XP_012469238.1| PREDICTED: rhodanese-like domain-containing ... 93 9e-17 gb|KJB08179.1| hypothetical protein B456_001G0706002, partial [G... 93 9e-17 ref|XP_009757053.1| PREDICTED: rhodanese-like domain-containing ... 92 1e-16 ref|XP_009757052.1| PREDICTED: rhodanese-like domain-containing ... 92 1e-16 >ref|XP_010277321.1| PREDICTED: rhodanese-like domain-containing protein 8, chloroplastic isoform X3 [Nelumbo nucifera] Length = 365 Score = 99.0 bits (245), Expect = 1e-18 Identities = 42/58 (72%), Positives = 53/58 (91%) Frame = -3 Query: 176 NDDDFVVVNFYRFVYIENPEEEVAKQLLFLQGFDIHGRIYINEQGINAQFSGPVKDSL 3 +DDDF+VVNFY FV+I+NPE+EVAK L F+QG DIHGR+Y+NEQGINAQ+SGP +D+L Sbjct: 90 SDDDFIVVNFYHFVFIKNPEDEVAKHLSFMQGLDIHGRVYLNEQGINAQYSGPSRDAL 147 >ref|XP_010277319.1| PREDICTED: rhodanese-like domain-containing protein 8, chloroplastic isoform X1 [Nelumbo nucifera] Length = 449 Score = 99.0 bits (245), Expect = 1e-18 Identities = 42/58 (72%), Positives = 53/58 (91%) Frame = -3 Query: 176 NDDDFVVVNFYRFVYIENPEEEVAKQLLFLQGFDIHGRIYINEQGINAQFSGPVKDSL 3 +DDDF+VVNFY FV+I+NPE+EVAK L F+QG DIHGR+Y+NEQGINAQ+SGP +D+L Sbjct: 90 SDDDFIVVNFYHFVFIKNPEDEVAKHLSFMQGLDIHGRVYLNEQGINAQYSGPSRDAL 147 >ref|XP_010663927.1| PREDICTED: rhodanese-like domain-containing protein 8, chloroplastic isoform X2 [Vitis vinifera] Length = 402 Score = 98.2 bits (243), Expect = 2e-18 Identities = 56/121 (46%), Positives = 73/121 (60%) Frame = -3 Query: 365 HKPLLPQCIHRRATRISFNPQTLPLFPSFRNSFSTKSKNEKNFNCKXXXXXXXXXXXXXX 186 HKPL + + ++S TL S ++S+++KN C Sbjct: 35 HKPL---SLFTQTLQLSATHLTLKALISI-----SRSESKKNVKCGCAVSSELS------ 80 Query: 185 XSINDDDFVVVNFYRFVYIENPEEEVAKQLLFLQGFDIHGRIYINEQGINAQFSGPVKDS 6 ND F+VVNFYRFV+I++PE EV+K L FLQGFDIHGR+YINEQGINAQ+SGP KD+ Sbjct: 81 ---NDGGFIVVNFYRFVFIQDPELEVSKHLSFLQGFDIHGRVYINEQGINAQYSGPSKDA 137 Query: 5 L 3 L Sbjct: 138 L 138 >ref|XP_002264379.2| PREDICTED: rhodanese-like domain-containing protein 8, chloroplastic isoform X1 [Vitis vinifera] Length = 441 Score = 98.2 bits (243), Expect = 2e-18 Identities = 56/121 (46%), Positives = 73/121 (60%) Frame = -3 Query: 365 HKPLLPQCIHRRATRISFNPQTLPLFPSFRNSFSTKSKNEKNFNCKXXXXXXXXXXXXXX 186 HKPL + + ++S TL S ++S+++KN C Sbjct: 35 HKPL---SLFTQTLQLSATHLTLKALISI-----SRSESKKNVKCGCAVSSELS------ 80 Query: 185 XSINDDDFVVVNFYRFVYIENPEEEVAKQLLFLQGFDIHGRIYINEQGINAQFSGPVKDS 6 ND F+VVNFYRFV+I++PE EV+K L FLQGFDIHGR+YINEQGINAQ+SGP KD+ Sbjct: 81 ---NDGGFIVVNFYRFVFIQDPELEVSKHLSFLQGFDIHGRVYINEQGINAQYSGPSKDA 137 Query: 5 L 3 L Sbjct: 138 L 138 >ref|XP_011086965.1| PREDICTED: rhodanese-like domain-containing protein 8, chloroplastic [Sesamum indicum] Length = 444 Score = 97.8 bits (242), Expect = 3e-18 Identities = 43/57 (75%), Positives = 53/57 (92%) Frame = -3 Query: 173 DDDFVVVNFYRFVYIENPEEEVAKQLLFLQGFDIHGRIYINEQGINAQFSGPVKDSL 3 DD+F+VVNFYRFV+I++PEEEV+K L F+QG DIHGRIY+NEQGINAQ+SGP KD+L Sbjct: 91 DDEFIVVNFYRFVFIQDPEEEVSKHLSFMQGRDIHGRIYLNEQGINAQYSGPSKDAL 147 >ref|XP_004252197.1| PREDICTED: rhodanese-like domain-containing protein 8, chloroplastic isoform X1 [Solanum lycopersicum] Length = 420 Score = 97.1 bits (240), Expect = 5e-18 Identities = 51/101 (50%), Positives = 68/101 (67%), Gaps = 5/101 (4%) Frame = -3 Query: 290 FPSFRNSFSTK-SKNEKN---FNCKXXXXXXXXXXXXXXXSI-NDDDFVVVNFYRFVYIE 126 FP+ R +T +KN+K CK + N+++F+VVNFYRFV+IE Sbjct: 24 FPNIRTILATTLNKNKKRVLPLRCKSLCLPSNGDWLEVPKEVENEEEFIVVNFYRFVFIE 83 Query: 125 NPEEEVAKQLLFLQGFDIHGRIYINEQGINAQFSGPVKDSL 3 +PEEEV+K L FL+G DIHGRIY+N+QGINAQ+SGP KD+L Sbjct: 84 DPEEEVSKHLSFLEGRDIHGRIYLNKQGINAQYSGPNKDAL 124 >ref|XP_006345730.1| PREDICTED: rhodanese-like domain-containing protein 8, chloroplastic-like isoform X1 [Solanum tuberosum] Length = 420 Score = 95.5 bits (236), Expect = 1e-17 Identities = 42/58 (72%), Positives = 53/58 (91%) Frame = -3 Query: 176 NDDDFVVVNFYRFVYIENPEEEVAKQLLFLQGFDIHGRIYINEQGINAQFSGPVKDSL 3 N+++F+VVNFYRFV+IE+PEEEV+K L FL+G DIHGRIY+N+QGINAQ+SGP KD L Sbjct: 67 NEEEFIVVNFYRFVFIEDPEEEVSKHLSFLEGRDIHGRIYLNKQGINAQYSGPNKDGL 124 >ref|XP_012829280.1| PREDICTED: rhodanese-like domain-containing protein 8, chloroplastic [Erythranthe guttatus] Length = 464 Score = 94.4 bits (233), Expect = 3e-17 Identities = 41/57 (71%), Positives = 51/57 (89%) Frame = -3 Query: 173 DDDFVVVNFYRFVYIENPEEEVAKQLLFLQGFDIHGRIYINEQGINAQFSGPVKDSL 3 D +F+VVNFYRFV+++NPEEEV + L F+QG DIHGRIY+NEQGINAQ+SGP KD+L Sbjct: 106 DAEFIVVNFYRFVFVQNPEEEVLRHLSFMQGRDIHGRIYLNEQGINAQYSGPSKDAL 162 >ref|XP_011047775.1| PREDICTED: rhodanese-like domain-containing protein 8, chloroplastic isoform X1 [Populus euphratica] Length = 458 Score = 94.4 bits (233), Expect = 3e-17 Identities = 42/56 (75%), Positives = 50/56 (89%) Frame = -3 Query: 170 DDFVVVNFYRFVYIENPEEEVAKQLLFLQGFDIHGRIYINEQGINAQFSGPVKDSL 3 +DF+VVNFYRFV+I +P EEVAK L FL+G DIHGRIY+NEQGINAQ+SGP KD+L Sbjct: 109 NDFIVVNFYRFVFINDPREEVAKHLSFLKGLDIHGRIYVNEQGINAQYSGPSKDAL 164 >gb|EYU17793.1| hypothetical protein MIMGU_mgv1a006537mg [Erythranthe guttata] Length = 440 Score = 94.4 bits (233), Expect = 3e-17 Identities = 41/57 (71%), Positives = 51/57 (89%) Frame = -3 Query: 173 DDDFVVVNFYRFVYIENPEEEVAKQLLFLQGFDIHGRIYINEQGINAQFSGPVKDSL 3 D +F+VVNFYRFV+++NPEEEV + L F+QG DIHGRIY+NEQGINAQ+SGP KD+L Sbjct: 82 DAEFIVVNFYRFVFVQNPEEEVLRHLSFMQGRDIHGRIYLNEQGINAQYSGPSKDAL 138 >ref|XP_006374262.1| hypothetical protein POPTR_0015s05490g [Populus trichocarpa] gi|550322019|gb|ERP52059.1| hypothetical protein POPTR_0015s05490g [Populus trichocarpa] Length = 460 Score = 94.4 bits (233), Expect = 3e-17 Identities = 42/56 (75%), Positives = 50/56 (89%) Frame = -3 Query: 170 DDFVVVNFYRFVYIENPEEEVAKQLLFLQGFDIHGRIYINEQGINAQFSGPVKDSL 3 +DF+VVNFYRFV+I +P EEVAK L FL+G DIHGRIY+NEQGINAQ+SGP KD+L Sbjct: 88 NDFIVVNFYRFVFINDPHEEVAKHLSFLKGLDIHGRIYVNEQGINAQYSGPSKDAL 143 >emb|CDO98592.1| unnamed protein product [Coffea canephora] Length = 446 Score = 93.6 bits (231), Expect = 5e-17 Identities = 41/57 (71%), Positives = 52/57 (91%) Frame = -3 Query: 173 DDDFVVVNFYRFVYIENPEEEVAKQLLFLQGFDIHGRIYINEQGINAQFSGPVKDSL 3 +D+FVVVNFY FV+IE+P+EEV+K L F+QG +IHGRIY+NEQGINAQ+SGP KD+L Sbjct: 93 EDEFVVVNFYHFVFIEDPQEEVSKHLSFMQGRNIHGRIYLNEQGINAQYSGPAKDAL 149 >gb|KHG14248.1| hypothetical protein F383_17325 [Gossypium arboreum] Length = 409 Score = 93.2 bits (230), Expect = 7e-17 Identities = 42/55 (76%), Positives = 49/55 (89%) Frame = -3 Query: 170 DDFVVVNFYRFVYIENPEEEVAKQLLFLQGFDIHGRIYINEQGINAQFSGPVKDS 6 DDFVVVNFYRFV+I++P+ E+AK L FL+G DIHGRIYINEQGINAQ+SGP K S Sbjct: 72 DDFVVVNFYRFVFIKDPQHEIAKHLTFLKGLDIHGRIYINEQGINAQYSGPSKHS 126 >ref|XP_009594000.1| PREDICTED: rhodanese-like domain-containing protein 8, chloroplastic isoform X2 [Nicotiana tomentosiformis] Length = 437 Score = 93.2 bits (230), Expect = 7e-17 Identities = 39/59 (66%), Positives = 54/59 (91%) Frame = -3 Query: 179 INDDDFVVVNFYRFVYIENPEEEVAKQLLFLQGFDIHGRIYINEQGINAQFSGPVKDSL 3 I++++F+VVNFYRFV+I++PEEEV K L F++G D+HGRIY+N+QGINAQ+SGP KD+L Sbjct: 79 IDEEEFIVVNFYRFVFIKDPEEEVTKHLSFMEGRDVHGRIYLNQQGINAQYSGPKKDAL 137 >ref|XP_012469270.1| PREDICTED: rhodanese-like domain-containing protein 8, chloroplastic isoform X3 [Gossypium raimondii] Length = 334 Score = 92.8 bits (229), Expect = 9e-17 Identities = 42/55 (76%), Positives = 48/55 (87%) Frame = -3 Query: 170 DDFVVVNFYRFVYIENPEEEVAKQLLFLQGFDIHGRIYINEQGINAQFSGPVKDS 6 DDFVVVNFYRFV+I +P+ E+AK L FL+G DIHGRIYINEQGINAQ+SGP K S Sbjct: 72 DDFVVVNFYRFVFIRDPQHEIAKHLTFLKGLDIHGRIYINEQGINAQYSGPSKHS 126 >ref|XP_012469262.1| PREDICTED: rhodanese-like domain-containing protein 8, chloroplastic isoform X2 [Gossypium raimondii] Length = 341 Score = 92.8 bits (229), Expect = 9e-17 Identities = 42/55 (76%), Positives = 48/55 (87%) Frame = -3 Query: 170 DDFVVVNFYRFVYIENPEEEVAKQLLFLQGFDIHGRIYINEQGINAQFSGPVKDS 6 DDFVVVNFYRFV+I +P+ E+AK L FL+G DIHGRIYINEQGINAQ+SGP K S Sbjct: 72 DDFVVVNFYRFVFIRDPQHEIAKHLTFLKGLDIHGRIYINEQGINAQYSGPSKHS 126 >ref|XP_012469238.1| PREDICTED: rhodanese-like domain-containing protein 8, chloroplastic isoform X1 [Gossypium raimondii] gi|823122066|ref|XP_012469245.1| PREDICTED: rhodanese-like domain-containing protein 8, chloroplastic isoform X1 [Gossypium raimondii] gi|823122068|ref|XP_012469254.1| PREDICTED: rhodanese-like domain-containing protein 8, chloroplastic isoform X1 [Gossypium raimondii] Length = 426 Score = 92.8 bits (229), Expect = 9e-17 Identities = 42/55 (76%), Positives = 48/55 (87%) Frame = -3 Query: 170 DDFVVVNFYRFVYIENPEEEVAKQLLFLQGFDIHGRIYINEQGINAQFSGPVKDS 6 DDFVVVNFYRFV+I +P+ E+AK L FL+G DIHGRIYINEQGINAQ+SGP K S Sbjct: 72 DDFVVVNFYRFVFIRDPQHEIAKHLTFLKGLDIHGRIYINEQGINAQYSGPSKHS 126 >gb|KJB08179.1| hypothetical protein B456_001G0706002, partial [Gossypium raimondii] gi|763740681|gb|KJB08180.1| hypothetical protein B456_001G0706002, partial [Gossypium raimondii] gi|763740682|gb|KJB08181.1| hypothetical protein B456_001G0706002, partial [Gossypium raimondii] gi|763740683|gb|KJB08182.1| hypothetical protein B456_001G0706002, partial [Gossypium raimondii] Length = 168 Score = 92.8 bits (229), Expect = 9e-17 Identities = 42/55 (76%), Positives = 48/55 (87%) Frame = -3 Query: 170 DDFVVVNFYRFVYIENPEEEVAKQLLFLQGFDIHGRIYINEQGINAQFSGPVKDS 6 DDFVVVNFYRFV+I +P+ E+AK L FL+G DIHGRIYINEQGINAQ+SGP K S Sbjct: 72 DDFVVVNFYRFVFIRDPQHEIAKHLTFLKGLDIHGRIYINEQGINAQYSGPSKHS 126 >ref|XP_009757053.1| PREDICTED: rhodanese-like domain-containing protein 8, chloroplastic isoform X2 [Nicotiana sylvestris] Length = 340 Score = 92.4 bits (228), Expect = 1e-16 Identities = 38/59 (64%), Positives = 54/59 (91%) Frame = -3 Query: 179 INDDDFVVVNFYRFVYIENPEEEVAKQLLFLQGFDIHGRIYINEQGINAQFSGPVKDSL 3 +++++F+VVNFYRFV+I++PEEEV K L F++G D+HGRIY+N+QGINAQ+SGP KD+L Sbjct: 74 LDEEEFIVVNFYRFVFIKDPEEEVTKHLSFMEGRDVHGRIYLNQQGINAQYSGPKKDAL 132 >ref|XP_009757052.1| PREDICTED: rhodanese-like domain-containing protein 8, chloroplastic isoform X1 [Nicotiana sylvestris] Length = 432 Score = 92.4 bits (228), Expect = 1e-16 Identities = 38/59 (64%), Positives = 54/59 (91%) Frame = -3 Query: 179 INDDDFVVVNFYRFVYIENPEEEVAKQLLFLQGFDIHGRIYINEQGINAQFSGPVKDSL 3 +++++F+VVNFYRFV+I++PEEEV K L F++G D+HGRIY+N+QGINAQ+SGP KD+L Sbjct: 74 LDEEEFIVVNFYRFVFIKDPEEEVTKHLSFMEGRDVHGRIYLNQQGINAQYSGPKKDAL 132