BLASTX nr result
ID: Papaver30_contig00039278
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver30_contig00039278 (1290 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP06436.1| unnamed protein product [Coffea canephora] 60 5e-06 >emb|CDP06436.1| unnamed protein product [Coffea canephora] Length = 170 Score = 59.7 bits (143), Expect = 5e-06 Identities = 28/36 (77%), Positives = 33/36 (91%) Frame = +2 Query: 8 ICTEGASKIHFTAGLKRTRSREAYEVIRDGVGTDKF 115 I TEG SK+HFTAG+K+TRSR+AYEV+RDGVG DKF Sbjct: 136 IATEG-SKLHFTAGMKKTRSRDAYEVLRDGVGIDKF 170