BLASTX nr result
ID: Papaver30_contig00039258
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver30_contig00039258 (462 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010275173.1| PREDICTED: pentatricopeptide repeat-containi... 91 4e-16 ref|XP_009773682.1| PREDICTED: pentatricopeptide repeat-containi... 88 2e-15 ref|XP_009773680.1| PREDICTED: pentatricopeptide repeat-containi... 88 2e-15 ref|XP_009773679.1| PREDICTED: pentatricopeptide repeat-containi... 88 2e-15 ref|XP_009592015.1| PREDICTED: pentatricopeptide repeat-containi... 88 2e-15 ref|XP_009592011.1| PREDICTED: pentatricopeptide repeat-containi... 88 2e-15 ref|XP_004249757.1| PREDICTED: pentatricopeptide repeat-containi... 87 5e-15 ref|XP_012459106.1| PREDICTED: pentatricopeptide repeat-containi... 87 6e-15 ref|XP_012459104.1| PREDICTED: pentatricopeptide repeat-containi... 87 6e-15 gb|KJB76398.1| hypothetical protein B456_012G086600 [Gossypium r... 87 6e-15 gb|KJB76397.1| hypothetical protein B456_012G086600 [Gossypium r... 87 6e-15 ref|XP_012459103.1| PREDICTED: pentatricopeptide repeat-containi... 87 6e-15 ref|XP_012459102.1| PREDICTED: pentatricopeptide repeat-containi... 87 6e-15 gb|KHG03831.1| hypothetical protein F383_26634 [Gossypium arboreum] 87 6e-15 gb|KHG03829.1| hypothetical protein F383_26634 [Gossypium arboreum] 87 6e-15 gb|KHG03828.1| hypothetical protein F383_26634 [Gossypium arboreum] 87 6e-15 ref|XP_006351327.1| PREDICTED: pentatricopeptide repeat-containi... 87 6e-15 ref|XP_007029495.1| Pentatricopeptide repeat-containing protein,... 87 6e-15 ref|XP_006850860.2| PREDICTED: pentatricopeptide repeat-containi... 86 8e-15 gb|ERN12441.1| hypothetical protein AMTR_s00025p00142780 [Ambore... 86 8e-15 >ref|XP_010275173.1| PREDICTED: pentatricopeptide repeat-containing protein At5g42310, mitochondrial-like [Nelumbo nucifera] Length = 536 Score = 90.5 bits (223), Expect = 4e-16 Identities = 43/56 (76%), Positives = 50/56 (89%) Frame = -3 Query: 460 PDVVTYSTLIKAFIRAKKYDQVLGIYDEMQSAGCTPDRKARELLQTALGVLEKRQG 293 PDVVTYSTL+KAFIRA+K+DQV GIY EM+ AGCTPDR+ARE+LQ AL VLE+R G Sbjct: 470 PDVVTYSTLMKAFIRARKFDQVPGIYKEMECAGCTPDRRAREMLQNALMVLEQRHG 525 >ref|XP_009773682.1| PREDICTED: pentatricopeptide repeat-containing protein At5g42310, mitochondrial-like isoform X3 [Nicotiana sylvestris] Length = 378 Score = 88.2 bits (217), Expect = 2e-15 Identities = 42/54 (77%), Positives = 50/54 (92%) Frame = -3 Query: 460 PDVVTYSTLIKAFIRAKKYDQVLGIYDEMQSAGCTPDRKARELLQTALGVLEKR 299 PDVVTYSTL+KAF+RAKK+DQV IY EM+SAGCTPDRKARE+LQ+AL +LE+R Sbjct: 323 PDVVTYSTLMKAFMRAKKFDQVPKIYSEMESAGCTPDRKAREVLQSALMILEQR 376 >ref|XP_009773680.1| PREDICTED: pentatricopeptide repeat-containing protein At5g42310, mitochondrial-like isoform X2 [Nicotiana sylvestris] gi|698567110|ref|XP_009773681.1| PREDICTED: pentatricopeptide repeat-containing protein At5g42310, mitochondrial-like isoform X2 [Nicotiana sylvestris] Length = 523 Score = 88.2 bits (217), Expect = 2e-15 Identities = 42/54 (77%), Positives = 50/54 (92%) Frame = -3 Query: 460 PDVVTYSTLIKAFIRAKKYDQVLGIYDEMQSAGCTPDRKARELLQTALGVLEKR 299 PDVVTYSTL+KAF+RAKK+DQV IY EM+SAGCTPDRKARE+LQ+AL +LE+R Sbjct: 468 PDVVTYSTLMKAFMRAKKFDQVPKIYSEMESAGCTPDRKAREVLQSALMILEQR 521 >ref|XP_009773679.1| PREDICTED: pentatricopeptide repeat-containing protein At5g42310, mitochondrial-like isoform X1 [Nicotiana sylvestris] Length = 560 Score = 88.2 bits (217), Expect = 2e-15 Identities = 42/54 (77%), Positives = 50/54 (92%) Frame = -3 Query: 460 PDVVTYSTLIKAFIRAKKYDQVLGIYDEMQSAGCTPDRKARELLQTALGVLEKR 299 PDVVTYSTL+KAF+RAKK+DQV IY EM+SAGCTPDRKARE+LQ+AL +LE+R Sbjct: 505 PDVVTYSTLMKAFMRAKKFDQVPKIYSEMESAGCTPDRKAREVLQSALMILEQR 558 >ref|XP_009592015.1| PREDICTED: pentatricopeptide repeat-containing protein At5g42310, mitochondrial-like isoform X3 [Nicotiana tomentosiformis] Length = 378 Score = 88.2 bits (217), Expect = 2e-15 Identities = 42/54 (77%), Positives = 50/54 (92%) Frame = -3 Query: 460 PDVVTYSTLIKAFIRAKKYDQVLGIYDEMQSAGCTPDRKARELLQTALGVLEKR 299 PDVVTYSTL+KAF+RAKK+DQV IY EM+SAGCTPDRKARE+LQ+AL +LE+R Sbjct: 323 PDVVTYSTLMKAFMRAKKFDQVPKIYSEMESAGCTPDRKAREVLQSALMILEQR 376 >ref|XP_009592011.1| PREDICTED: pentatricopeptide repeat-containing protein At5g42310, mitochondrial-like isoform X1 [Nicotiana tomentosiformis] gi|697166361|ref|XP_009592012.1| PREDICTED: pentatricopeptide repeat-containing protein At5g42310, mitochondrial-like isoform X1 [Nicotiana tomentosiformis] gi|697166363|ref|XP_009592013.1| PREDICTED: pentatricopeptide repeat-containing protein At5g42310, mitochondrial-like isoform X1 [Nicotiana tomentosiformis] Length = 523 Score = 88.2 bits (217), Expect = 2e-15 Identities = 42/54 (77%), Positives = 50/54 (92%) Frame = -3 Query: 460 PDVVTYSTLIKAFIRAKKYDQVLGIYDEMQSAGCTPDRKARELLQTALGVLEKR 299 PDVVTYSTL+KAF+RAKK+DQV IY EM+SAGCTPDRKARE+LQ+AL +LE+R Sbjct: 468 PDVVTYSTLMKAFMRAKKFDQVPKIYSEMESAGCTPDRKAREVLQSALMILEQR 521 >ref|XP_004249757.1| PREDICTED: pentatricopeptide repeat-containing protein At5g42310, mitochondrial-like [Solanum lycopersicum] gi|723738498|ref|XP_010312136.1| PREDICTED: pentatricopeptide repeat-containing protein At5g42310, mitochondrial-like [Solanum lycopersicum] gi|723738501|ref|XP_010312137.1| PREDICTED: pentatricopeptide repeat-containing protein At5g42310, mitochondrial-like [Solanum lycopersicum] gi|723738504|ref|XP_010312138.1| PREDICTED: pentatricopeptide repeat-containing protein At5g42310, mitochondrial-like [Solanum lycopersicum] gi|723738507|ref|XP_010312139.1| PREDICTED: pentatricopeptide repeat-containing protein At5g42310, mitochondrial-like [Solanum lycopersicum] gi|723738510|ref|XP_010312140.1| PREDICTED: pentatricopeptide repeat-containing protein At5g42310, mitochondrial-like [Solanum lycopersicum] gi|723738513|ref|XP_010312142.1| PREDICTED: pentatricopeptide repeat-containing protein At5g42310, mitochondrial-like [Solanum lycopersicum] Length = 523 Score = 87.0 bits (214), Expect = 5e-15 Identities = 40/54 (74%), Positives = 49/54 (90%) Frame = -3 Query: 460 PDVVTYSTLIKAFIRAKKYDQVLGIYDEMQSAGCTPDRKARELLQTALGVLEKR 299 PDV+TYSTL+KAF+RAKK+DQV IY EM+S GCTPDRKARE+LQ+AL +LE+R Sbjct: 468 PDVITYSTLMKAFLRAKKFDQVPKIYSEMESTGCTPDRKAREMLQSALMILEQR 521 >ref|XP_012459106.1| PREDICTED: pentatricopeptide repeat-containing protein At5g42310, mitochondrial-like isoform X4 [Gossypium raimondii] Length = 485 Score = 86.7 bits (213), Expect = 6e-15 Identities = 42/54 (77%), Positives = 49/54 (90%) Frame = -3 Query: 460 PDVVTYSTLIKAFIRAKKYDQVLGIYDEMQSAGCTPDRKARELLQTALGVLEKR 299 PDVVTYSTL+KAFIRAKK+D+V IY EM+S GCTPDRKAR++LQTAL VLE+R Sbjct: 428 PDVVTYSTLMKAFIRAKKFDKVPEIYKEMESYGCTPDRKARQMLQTALMVLERR 481 >ref|XP_012459104.1| PREDICTED: pentatricopeptide repeat-containing protein At5g42310, mitochondrial-like isoform X3 [Gossypium raimondii] gi|823252980|ref|XP_012459105.1| PREDICTED: pentatricopeptide repeat-containing protein At5g42310, mitochondrial-like isoform X3 [Gossypium raimondii] Length = 490 Score = 86.7 bits (213), Expect = 6e-15 Identities = 42/54 (77%), Positives = 49/54 (90%) Frame = -3 Query: 460 PDVVTYSTLIKAFIRAKKYDQVLGIYDEMQSAGCTPDRKARELLQTALGVLEKR 299 PDVVTYSTL+KAFIRAKK+D+V IY EM+S GCTPDRKAR++LQTAL VLE+R Sbjct: 433 PDVVTYSTLMKAFIRAKKFDKVPEIYKEMESYGCTPDRKARQMLQTALMVLERR 486 >gb|KJB76398.1| hypothetical protein B456_012G086600 [Gossypium raimondii] Length = 487 Score = 86.7 bits (213), Expect = 6e-15 Identities = 42/54 (77%), Positives = 49/54 (90%) Frame = -3 Query: 460 PDVVTYSTLIKAFIRAKKYDQVLGIYDEMQSAGCTPDRKARELLQTALGVLEKR 299 PDVVTYSTL+KAFIRAKK+D+V IY EM+S GCTPDRKAR++LQTAL VLE+R Sbjct: 433 PDVVTYSTLMKAFIRAKKFDKVPEIYKEMESYGCTPDRKARQMLQTALMVLERR 486 >gb|KJB76397.1| hypothetical protein B456_012G086600 [Gossypium raimondii] Length = 482 Score = 86.7 bits (213), Expect = 6e-15 Identities = 42/54 (77%), Positives = 49/54 (90%) Frame = -3 Query: 460 PDVVTYSTLIKAFIRAKKYDQVLGIYDEMQSAGCTPDRKARELLQTALGVLEKR 299 PDVVTYSTL+KAFIRAKK+D+V IY EM+S GCTPDRKAR++LQTAL VLE+R Sbjct: 428 PDVVTYSTLMKAFIRAKKFDKVPEIYKEMESYGCTPDRKARQMLQTALMVLERR 481 >ref|XP_012459103.1| PREDICTED: pentatricopeptide repeat-containing protein At5g42310, mitochondrial-like isoform X2 [Gossypium raimondii] gi|763809494|gb|KJB76396.1| hypothetical protein B456_012G086600 [Gossypium raimondii] Length = 511 Score = 86.7 bits (213), Expect = 6e-15 Identities = 42/54 (77%), Positives = 49/54 (90%) Frame = -3 Query: 460 PDVVTYSTLIKAFIRAKKYDQVLGIYDEMQSAGCTPDRKARELLQTALGVLEKR 299 PDVVTYSTL+KAFIRAKK+D+V IY EM+S GCTPDRKAR++LQTAL VLE+R Sbjct: 457 PDVVTYSTLMKAFIRAKKFDKVPEIYKEMESYGCTPDRKARQMLQTALMVLERR 510 >ref|XP_012459102.1| PREDICTED: pentatricopeptide repeat-containing protein At5g42310, mitochondrial-like isoform X1 [Gossypium raimondii] gi|763809493|gb|KJB76395.1| hypothetical protein B456_012G086600 [Gossypium raimondii] Length = 514 Score = 86.7 bits (213), Expect = 6e-15 Identities = 42/54 (77%), Positives = 49/54 (90%) Frame = -3 Query: 460 PDVVTYSTLIKAFIRAKKYDQVLGIYDEMQSAGCTPDRKARELLQTALGVLEKR 299 PDVVTYSTL+KAFIRAKK+D+V IY EM+S GCTPDRKAR++LQTAL VLE+R Sbjct: 457 PDVVTYSTLMKAFIRAKKFDKVPEIYKEMESYGCTPDRKARQMLQTALMVLERR 510 >gb|KHG03831.1| hypothetical protein F383_26634 [Gossypium arboreum] Length = 511 Score = 86.7 bits (213), Expect = 6e-15 Identities = 42/54 (77%), Positives = 49/54 (90%) Frame = -3 Query: 460 PDVVTYSTLIKAFIRAKKYDQVLGIYDEMQSAGCTPDRKARELLQTALGVLEKR 299 PDVVTYSTL+KAFIRAKK+D+V IY EM+S GCTPDRKAR++LQTAL VLE+R Sbjct: 457 PDVVTYSTLMKAFIRAKKFDKVPEIYKEMESYGCTPDRKARQMLQTALMVLERR 510 >gb|KHG03829.1| hypothetical protein F383_26634 [Gossypium arboreum] Length = 1628 Score = 86.7 bits (213), Expect = 6e-15 Identities = 42/54 (77%), Positives = 49/54 (90%) Frame = -3 Query: 460 PDVVTYSTLIKAFIRAKKYDQVLGIYDEMQSAGCTPDRKARELLQTALGVLEKR 299 PDVVTYSTL+KAFIRAKK+D+V IY EM+S GCTPDRKAR++LQTAL VLE+R Sbjct: 457 PDVVTYSTLMKAFIRAKKFDKVPEIYKEMESYGCTPDRKARQMLQTALMVLERR 510 >gb|KHG03828.1| hypothetical protein F383_26634 [Gossypium arboreum] Length = 1639 Score = 86.7 bits (213), Expect = 6e-15 Identities = 42/54 (77%), Positives = 49/54 (90%) Frame = -3 Query: 460 PDVVTYSTLIKAFIRAKKYDQVLGIYDEMQSAGCTPDRKARELLQTALGVLEKR 299 PDVVTYSTL+KAFIRAKK+D+V IY EM+S GCTPDRKAR++LQTAL VLE+R Sbjct: 457 PDVVTYSTLMKAFIRAKKFDKVPEIYKEMESYGCTPDRKARQMLQTALMVLERR 510 >ref|XP_006351327.1| PREDICTED: pentatricopeptide repeat-containing protein At5g42310, mitochondrial-like isoform X1 [Solanum tuberosum] gi|565369409|ref|XP_006351328.1| PREDICTED: pentatricopeptide repeat-containing protein At5g42310, mitochondrial-like isoform X2 [Solanum tuberosum] gi|565369411|ref|XP_006351329.1| PREDICTED: pentatricopeptide repeat-containing protein At5g42310, mitochondrial-like isoform X3 [Solanum tuberosum] Length = 523 Score = 86.7 bits (213), Expect = 6e-15 Identities = 40/54 (74%), Positives = 49/54 (90%) Frame = -3 Query: 460 PDVVTYSTLIKAFIRAKKYDQVLGIYDEMQSAGCTPDRKARELLQTALGVLEKR 299 PDV+TYSTL+KAF+RAKK+DQV IY EM+S GCTPDRKARE+LQ+AL +LE+R Sbjct: 468 PDVITYSTLMKAFMRAKKFDQVPKIYSEMESTGCTPDRKAREMLQSALMILEQR 521 >ref|XP_007029495.1| Pentatricopeptide repeat-containing protein, putative isoform 1 [Theobroma cacao] gi|508718100|gb|EOY09997.1| Pentatricopeptide repeat-containing protein, putative isoform 1 [Theobroma cacao] Length = 513 Score = 86.7 bits (213), Expect = 6e-15 Identities = 41/54 (75%), Positives = 50/54 (92%) Frame = -3 Query: 460 PDVVTYSTLIKAFIRAKKYDQVLGIYDEMQSAGCTPDRKARELLQTALGVLEKR 299 PDV+TYSTL+KAFIRAKK+D+V IY EM+S+GCTPDRKAR++LQTAL VLE+R Sbjct: 459 PDVITYSTLMKAFIRAKKFDRVPEIYREMESSGCTPDRKARQMLQTALMVLEQR 512 >ref|XP_006850860.2| PREDICTED: pentatricopeptide repeat-containing protein At5g42310, mitochondrial [Amborella trichopoda] Length = 492 Score = 86.3 bits (212), Expect = 8e-15 Identities = 40/56 (71%), Positives = 48/56 (85%) Frame = -3 Query: 460 PDVVTYSTLIKAFIRAKKYDQVLGIYDEMQSAGCTPDRKARELLQTALGVLEKRQG 293 PDVVTYSTL+KAF RA+K+DQV +Y EM+SAGC PDRKARE+LQ AL +LE+R G Sbjct: 434 PDVVTYSTLMKAFFRARKFDQVQEVYKEMESAGCVPDRKAREMLQNALLILEQRHG 489 >gb|ERN12441.1| hypothetical protein AMTR_s00025p00142780 [Amborella trichopoda] Length = 416 Score = 86.3 bits (212), Expect = 8e-15 Identities = 40/56 (71%), Positives = 48/56 (85%) Frame = -3 Query: 460 PDVVTYSTLIKAFIRAKKYDQVLGIYDEMQSAGCTPDRKARELLQTALGVLEKRQG 293 PDVVTYSTL+KAF RA+K+DQV +Y EM+SAGC PDRKARE+LQ AL +LE+R G Sbjct: 358 PDVVTYSTLMKAFFRARKFDQVQEVYKEMESAGCVPDRKAREMLQNALLILEQRHG 413