BLASTX nr result
ID: Papaver30_contig00039007
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver30_contig00039007 (420 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_008225150.1| PREDICTED: LOW QUALITY PROTEIN: uncharacteri... 57 4e-06 ref|XP_007214609.1| hypothetical protein PRUPE_ppa000115mg [Prun... 57 5e-06 >ref|XP_008225150.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC103324817 [Prunus mume] Length = 1759 Score = 57.4 bits (137), Expect = 4e-06 Identities = 28/60 (46%), Positives = 36/60 (60%) Frame = -3 Query: 289 H*MLAKRCKAWGFSICICEQQLNLLTWPEVFCLFAFSAVLGPLLKKS*TVFFFCDDNEEL 110 H + + AWGF I +Q LNLLTWPE+F A SA GP LKK T + + DN+E+ Sbjct: 631 HPQIVEGAYAWGFDIRNWQQHLNLLTWPEIFRQLALSAGFGPRLKKRSTAWSYSPDNDEV 690 >ref|XP_007214609.1| hypothetical protein PRUPE_ppa000115mg [Prunus persica] gi|462410474|gb|EMJ15808.1| hypothetical protein PRUPE_ppa000115mg [Prunus persica] Length = 1762 Score = 57.0 bits (136), Expect = 5e-06 Identities = 28/59 (47%), Positives = 35/59 (59%) Frame = -3 Query: 289 H*MLAKRCKAWGFSICICEQQLNLLTWPEVFCLFAFSAVLGPLLKKS*TVFFFCDDNEE 113 H + + AWGF I +Q LNLLTWPE+F A SA GP LKK T + + DN+E Sbjct: 628 HPQIVEGAYAWGFDIRNWQQHLNLLTWPEIFRQLALSAGFGPQLKKRSTAWSYSPDNDE 686