BLASTX nr result
ID: Papaver30_contig00036960
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver30_contig00036960 (587 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KRH37539.1| hypothetical protein GLYMA_09G072400 [Glycine max] 57 5e-06 gb|KHN12305.1| DEAD-box ATP-dependent RNA helicase 17 [Glycine s... 57 5e-06 ref|XP_012071299.1| PREDICTED: DEAD-box ATP-dependent RNA helica... 57 7e-06 gb|KDP46352.1| hypothetical protein JCGZ_10192 [Jatropha curcas] 57 7e-06 >gb|KRH37539.1| hypothetical protein GLYMA_09G072400 [Glycine max] Length = 539 Score = 57.4 bits (137), Expect = 5e-06 Identities = 31/55 (56%), Positives = 37/55 (67%) Frame = -3 Query: 282 LVLVPTRESCIQVKEIPQKLLH*FHWMVLGLLMGREEHIIEASQRYINAILPIAT 118 LVLVPTRE C+QV EI QKLLH FHW+V G +MG E+ E S+ + IAT Sbjct: 104 LVLVPTRELCLQVYEILQKLLHRFHWIVPGYIMGGEKRSKEKSRLRKGISILIAT 158 >gb|KHN12305.1| DEAD-box ATP-dependent RNA helicase 17 [Glycine soja] Length = 596 Score = 57.4 bits (137), Expect = 5e-06 Identities = 31/55 (56%), Positives = 37/55 (67%) Frame = -3 Query: 282 LVLVPTRESCIQVKEIPQKLLH*FHWMVLGLLMGREEHIIEASQRYINAILPIAT 118 LVLVPTRE C+QV EI QKLLH FHW+V G +MG E+ E S+ + IAT Sbjct: 104 LVLVPTRELCLQVYEILQKLLHRFHWIVPGYIMGGEKRSKEKSRLRKGISILIAT 158 >ref|XP_012071299.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 17-like [Jatropha curcas] Length = 599 Score = 57.0 bits (136), Expect = 7e-06 Identities = 31/55 (56%), Positives = 37/55 (67%) Frame = -3 Query: 282 LVLVPTRESCIQVKEIPQKLLH*FHWMVLGLLMGREEHIIEASQRYINAILPIAT 118 LVLVPTRE CIQV EI QKLLH FHW+V G +MG E+ E ++ + IAT Sbjct: 106 LVLVPTRELCIQVYEILQKLLHRFHWIVPGYVMGGEKRTKEKARLRKGISILIAT 160 >gb|KDP46352.1| hypothetical protein JCGZ_10192 [Jatropha curcas] Length = 593 Score = 57.0 bits (136), Expect = 7e-06 Identities = 31/55 (56%), Positives = 37/55 (67%) Frame = -3 Query: 282 LVLVPTRESCIQVKEIPQKLLH*FHWMVLGLLMGREEHIIEASQRYINAILPIAT 118 LVLVPTRE CIQV EI QKLLH FHW+V G +MG E+ E ++ + IAT Sbjct: 100 LVLVPTRELCIQVYEILQKLLHRFHWIVPGYVMGGEKRTKEKARLRKGISILIAT 154