BLASTX nr result
ID: Papaver30_contig00036654
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver30_contig00036654 (620 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006342787.1| PREDICTED: mitochondrial thiamine pyrophosph... 86 2e-14 ref|XP_004229228.1| PREDICTED: mitochondrial thiamine pyrophosph... 86 2e-14 ref|XP_009619481.1| PREDICTED: mitochondrial thiamine pyrophosph... 83 1e-13 ref|XP_006349808.1| PREDICTED: mitochondrial thiamine pyrophosph... 83 1e-13 gb|KNA24734.1| hypothetical protein SOVF_013170 [Spinacia oleracea] 82 2e-13 ref|XP_008340819.1| PREDICTED: mitochondrial thiamine pyrophosph... 82 2e-13 ref|XP_011627443.1| PREDICTED: mitochondrial thiamine pyrophosph... 82 3e-13 ref|XP_002314452.2| mitochondrial substrate carrier family prote... 82 3e-13 gb|ERN16985.1| hypothetical protein AMTR_s00057p00207420 [Ambore... 82 3e-13 ref|XP_009790140.1| PREDICTED: mitochondrial thiamine pyrophosph... 81 4e-13 ref|XP_007222579.1| hypothetical protein PRUPE_ppa008444mg [Prun... 81 4e-13 ref|XP_010921797.1| PREDICTED: mitochondrial thiamine pyrophosph... 80 7e-13 ref|XP_010921795.1| PREDICTED: mitochondrial thiamine pyrophosph... 80 7e-13 emb|CDP19540.1| unnamed protein product [Coffea canephora] 80 7e-13 ref|XP_002272682.1| PREDICTED: mitochondrial thiamine pyrophosph... 80 7e-13 ref|XP_008223169.1| PREDICTED: mitochondrial thiamine pyrophosph... 80 9e-13 ref|XP_009339821.1| PREDICTED: mitochondrial thiamine pyrophosph... 80 1e-12 gb|KMT06631.1| hypothetical protein BVRB_7g157990 [Beta vulgaris... 79 2e-12 ref|XP_011044518.1| PREDICTED: mitochondrial thiamine pyrophosph... 79 2e-12 ref|XP_010683591.1| PREDICTED: mitochondrial thiamine pyrophosph... 79 2e-12 >ref|XP_006342787.1| PREDICTED: mitochondrial thiamine pyrophosphate carrier-like [Solanum tuberosum] Length = 331 Score = 85.5 bits (210), Expect = 2e-14 Identities = 40/44 (90%), Positives = 42/44 (95%) Frame = +2 Query: 2 ILVTEGWAGLYKGIVPSVIKAAPAGAVTFVAYEYTSEWLESHLT 133 IL+ EGWAGLYKGIVPSVIKAAPAGAVTFVAYEYTS+WLES LT Sbjct: 288 ILIEEGWAGLYKGIVPSVIKAAPAGAVTFVAYEYTSDWLESKLT 331 >ref|XP_004229228.1| PREDICTED: mitochondrial thiamine pyrophosphate carrier-like [Solanum lycopersicum] Length = 331 Score = 85.5 bits (210), Expect = 2e-14 Identities = 40/44 (90%), Positives = 42/44 (95%) Frame = +2 Query: 2 ILVTEGWAGLYKGIVPSVIKAAPAGAVTFVAYEYTSEWLESHLT 133 IL+ EGWAGLYKGIVPSVIKAAPAGAVTFVAYEYTS+WLES LT Sbjct: 288 ILIEEGWAGLYKGIVPSVIKAAPAGAVTFVAYEYTSDWLESKLT 331 >ref|XP_009619481.1| PREDICTED: mitochondrial thiamine pyrophosphate carrier-like [Nicotiana tomentosiformis] Length = 329 Score = 83.2 bits (204), Expect = 1e-13 Identities = 38/44 (86%), Positives = 42/44 (95%) Frame = +2 Query: 2 ILVTEGWAGLYKGIVPSVIKAAPAGAVTFVAYEYTSEWLESHLT 133 IL+ EGWAGLYKGIVPS++KAAPAGAVTFVAYEYTS+WLES LT Sbjct: 286 ILLEEGWAGLYKGIVPSIVKAAPAGAVTFVAYEYTSDWLESILT 329 >ref|XP_006349808.1| PREDICTED: mitochondrial thiamine pyrophosphate carrier-like [Solanum tuberosum] Length = 329 Score = 83.2 bits (204), Expect = 1e-13 Identities = 38/44 (86%), Positives = 42/44 (95%) Frame = +2 Query: 2 ILVTEGWAGLYKGIVPSVIKAAPAGAVTFVAYEYTSEWLESHLT 133 IL+ EGWAGLYKGIVPS++KAAPAGAVTFVAYEYTS+WLES LT Sbjct: 286 ILLEEGWAGLYKGIVPSIVKAAPAGAVTFVAYEYTSDWLESILT 329 >gb|KNA24734.1| hypothetical protein SOVF_013170 [Spinacia oleracea] Length = 332 Score = 82.0 bits (201), Expect = 2e-13 Identities = 38/44 (86%), Positives = 40/44 (90%) Frame = +2 Query: 2 ILVTEGWAGLYKGIVPSVIKAAPAGAVTFVAYEYTSEWLESHLT 133 IL EGW GLYKGIVPS++KAAPAGAVTFVAYEYTSEWLES LT Sbjct: 287 ILQVEGWGGLYKGIVPSIVKAAPAGAVTFVAYEYTSEWLESVLT 330 >ref|XP_008340819.1| PREDICTED: mitochondrial thiamine pyrophosphate carrier [Malus domestica] Length = 331 Score = 82.0 bits (201), Expect = 2e-13 Identities = 38/44 (86%), Positives = 40/44 (90%) Frame = +2 Query: 2 ILVTEGWAGLYKGIVPSVIKAAPAGAVTFVAYEYTSEWLESHLT 133 IL EGWAGLYKGIVPS +KAAPAGAVTFVAYEYTS+WLES LT Sbjct: 288 ILQMEGWAGLYKGIVPSTVKAAPAGAVTFVAYEYTSDWLESRLT 331 >ref|XP_011627443.1| PREDICTED: mitochondrial thiamine pyrophosphate carrier isoform X1 [Amborella trichopoda] Length = 331 Score = 81.6 bits (200), Expect = 3e-13 Identities = 38/44 (86%), Positives = 41/44 (93%) Frame = +2 Query: 2 ILVTEGWAGLYKGIVPSVIKAAPAGAVTFVAYEYTSEWLESHLT 133 I+ EGWAGLYKGIVPS+IKAAPAGAVTFVAYEYTS+WLES LT Sbjct: 288 IVQAEGWAGLYKGIVPSIIKAAPAGAVTFVAYEYTSDWLESILT 331 >ref|XP_002314452.2| mitochondrial substrate carrier family protein [Populus trichocarpa] gi|550328947|gb|EEF00623.2| mitochondrial substrate carrier family protein [Populus trichocarpa] Length = 341 Score = 81.6 bits (200), Expect = 3e-13 Identities = 38/44 (86%), Positives = 41/44 (93%) Frame = +2 Query: 2 ILVTEGWAGLYKGIVPSVIKAAPAGAVTFVAYEYTSEWLESHLT 133 IL TEGWAGLYKGIVPS +KAAPAGAVTFVAYE+TS+WLES LT Sbjct: 298 ILQTEGWAGLYKGIVPSTVKAAPAGAVTFVAYEFTSDWLESILT 341 >gb|ERN16985.1| hypothetical protein AMTR_s00057p00207420 [Amborella trichopoda] Length = 369 Score = 81.6 bits (200), Expect = 3e-13 Identities = 38/44 (86%), Positives = 41/44 (93%) Frame = +2 Query: 2 ILVTEGWAGLYKGIVPSVIKAAPAGAVTFVAYEYTSEWLESHLT 133 I+ EGWAGLYKGIVPS+IKAAPAGAVTFVAYEYTS+WLES LT Sbjct: 326 IVQAEGWAGLYKGIVPSIIKAAPAGAVTFVAYEYTSDWLESILT 369 >ref|XP_009790140.1| PREDICTED: mitochondrial thiamine pyrophosphate carrier-like [Nicotiana sylvestris] Length = 329 Score = 81.3 bits (199), Expect = 4e-13 Identities = 37/43 (86%), Positives = 41/43 (95%) Frame = +2 Query: 2 ILVTEGWAGLYKGIVPSVIKAAPAGAVTFVAYEYTSEWLESHL 130 IL+ EGWAGLYKGIVPS++KAAPAGAVTFVAYEYTS+WLES L Sbjct: 286 ILLEEGWAGLYKGIVPSIVKAAPAGAVTFVAYEYTSDWLESIL 328 >ref|XP_007222579.1| hypothetical protein PRUPE_ppa008444mg [Prunus persica] gi|462419515|gb|EMJ23778.1| hypothetical protein PRUPE_ppa008444mg [Prunus persica] Length = 331 Score = 81.3 bits (199), Expect = 4e-13 Identities = 38/44 (86%), Positives = 40/44 (90%) Frame = +2 Query: 2 ILVTEGWAGLYKGIVPSVIKAAPAGAVTFVAYEYTSEWLESHLT 133 IL EGWAGLYKGIVPS +KAAPAGAVTFVAYEYTS+WLES LT Sbjct: 288 ILQKEGWAGLYKGIVPSTVKAAPAGAVTFVAYEYTSDWLESALT 331 >ref|XP_010921797.1| PREDICTED: mitochondrial thiamine pyrophosphate carrier-like isoform X3 [Elaeis guineensis] Length = 314 Score = 80.5 bits (197), Expect = 7e-13 Identities = 37/44 (84%), Positives = 41/44 (93%) Frame = +2 Query: 2 ILVTEGWAGLYKGIVPSVIKAAPAGAVTFVAYEYTSEWLESHLT 133 IL TEGWAGLYKGI PS++K+APAGAVTFVAYEYTS+WLES LT Sbjct: 271 ILQTEGWAGLYKGIFPSLVKSAPAGAVTFVAYEYTSDWLESVLT 314 >ref|XP_010921795.1| PREDICTED: mitochondrial thiamine pyrophosphate carrier-like isoform X1 [Elaeis guineensis] Length = 331 Score = 80.5 bits (197), Expect = 7e-13 Identities = 37/44 (84%), Positives = 41/44 (93%) Frame = +2 Query: 2 ILVTEGWAGLYKGIVPSVIKAAPAGAVTFVAYEYTSEWLESHLT 133 IL TEGWAGLYKGI PS++K+APAGAVTFVAYEYTS+WLES LT Sbjct: 288 ILQTEGWAGLYKGIFPSLVKSAPAGAVTFVAYEYTSDWLESVLT 331 >emb|CDP19540.1| unnamed protein product [Coffea canephora] Length = 329 Score = 80.5 bits (197), Expect = 7e-13 Identities = 36/41 (87%), Positives = 40/41 (97%) Frame = +2 Query: 2 ILVTEGWAGLYKGIVPSVIKAAPAGAVTFVAYEYTSEWLES 124 IL TEGWAGLYKGIVPS++KAAPAGAVTFVAYE+TS+WLES Sbjct: 286 ILQTEGWAGLYKGIVPSIVKAAPAGAVTFVAYEFTSDWLES 326 >ref|XP_002272682.1| PREDICTED: mitochondrial thiamine pyrophosphate carrier [Vitis vinifera] gi|731388753|ref|XP_010649727.1| PREDICTED: mitochondrial thiamine pyrophosphate carrier [Vitis vinifera] gi|731388756|ref|XP_010649728.1| PREDICTED: mitochondrial thiamine pyrophosphate carrier [Vitis vinifera] gi|731388758|ref|XP_010649729.1| PREDICTED: mitochondrial thiamine pyrophosphate carrier [Vitis vinifera] gi|731388760|ref|XP_010649730.1| PREDICTED: mitochondrial thiamine pyrophosphate carrier [Vitis vinifera] gi|297736865|emb|CBI26066.3| unnamed protein product [Vitis vinifera] Length = 330 Score = 80.5 bits (197), Expect = 7e-13 Identities = 36/44 (81%), Positives = 42/44 (95%) Frame = +2 Query: 2 ILVTEGWAGLYKGIVPSVIKAAPAGAVTFVAYEYTSEWLESHLT 133 IL+ EGWAGLYKGIVPS+IK+APAGAVTFVAYE+TS+WLES +T Sbjct: 287 ILLVEGWAGLYKGIVPSIIKSAPAGAVTFVAYEFTSDWLESMVT 330 >ref|XP_008223169.1| PREDICTED: mitochondrial thiamine pyrophosphate carrier 1-like [Prunus mume] Length = 331 Score = 80.1 bits (196), Expect = 9e-13 Identities = 37/44 (84%), Positives = 40/44 (90%) Frame = +2 Query: 2 ILVTEGWAGLYKGIVPSVIKAAPAGAVTFVAYEYTSEWLESHLT 133 IL EGWAGLYKGIVPS +KAAPAGAVTFVAYEYTS+WLE+ LT Sbjct: 288 ILQREGWAGLYKGIVPSTVKAAPAGAVTFVAYEYTSDWLEAALT 331 >ref|XP_009339821.1| PREDICTED: mitochondrial thiamine pyrophosphate carrier-like [Pyrus x bretschneideri] Length = 331 Score = 79.7 bits (195), Expect = 1e-12 Identities = 37/44 (84%), Positives = 39/44 (88%) Frame = +2 Query: 2 ILVTEGWAGLYKGIVPSVIKAAPAGAVTFVAYEYTSEWLESHLT 133 IL EGWAGLYKGIVPS +KAAPA AVTFVAYEYTS+WLES LT Sbjct: 288 ILQMEGWAGLYKGIVPSTVKAAPAAAVTFVAYEYTSDWLESRLT 331 >gb|KMT06631.1| hypothetical protein BVRB_7g157990 [Beta vulgaris subsp. vulgaris] Length = 278 Score = 79.3 bits (194), Expect = 2e-12 Identities = 36/44 (81%), Positives = 41/44 (93%) Frame = +2 Query: 2 ILVTEGWAGLYKGIVPSVIKAAPAGAVTFVAYEYTSEWLESHLT 133 IL EGWAGLYKGIVPS++KAAPAGAVTFVAYE++SEWLES +T Sbjct: 233 ILQAEGWAGLYKGIVPSIVKAAPAGAVTFVAYEFSSEWLESIVT 276 >ref|XP_011044518.1| PREDICTED: mitochondrial thiamine pyrophosphate carrier-like [Populus euphratica] Length = 341 Score = 79.3 bits (194), Expect = 2e-12 Identities = 37/44 (84%), Positives = 40/44 (90%) Frame = +2 Query: 2 ILVTEGWAGLYKGIVPSVIKAAPAGAVTFVAYEYTSEWLESHLT 133 IL EGWAGLYKGIVPS +KAAPAGAVTFVAYE+TS+WLES LT Sbjct: 298 ILQMEGWAGLYKGIVPSTVKAAPAGAVTFVAYEFTSDWLESILT 341 >ref|XP_010683591.1| PREDICTED: mitochondrial thiamine pyrophosphate carrier-like [Beta vulgaris subsp. vulgaris] gi|731344770|ref|XP_010683592.1| PREDICTED: mitochondrial thiamine pyrophosphate carrier-like [Beta vulgaris subsp. vulgaris] Length = 332 Score = 79.3 bits (194), Expect = 2e-12 Identities = 36/44 (81%), Positives = 41/44 (93%) Frame = +2 Query: 2 ILVTEGWAGLYKGIVPSVIKAAPAGAVTFVAYEYTSEWLESHLT 133 IL EGWAGLYKGIVPS++KAAPAGAVTFVAYE++SEWLES +T Sbjct: 287 ILQAEGWAGLYKGIVPSIVKAAPAGAVTFVAYEFSSEWLESIVT 330