BLASTX nr result
ID: Papaver30_contig00036285
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver30_contig00036285 (677 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_008798798.1| PREDICTED: GRAM domain-containing protein 1A... 100 6e-19 ref|XP_008798797.1| PREDICTED: GRAM domain-containing protein 1A... 100 6e-19 ref|XP_010661402.1| PREDICTED: GRAM domain-containing protein 1A... 99 2e-18 ref|XP_002271102.1| PREDICTED: GRAM domain-containing protein 1A... 99 2e-18 gb|EEE70134.1| hypothetical protein OsJ_30169 [Oryza sativa Japo... 99 3e-18 ref|XP_010258771.1| PREDICTED: uncharacterized membrane protein ... 98 4e-18 ref|XP_010238210.1| PREDICTED: uncharacterized membrane protein ... 98 5e-18 ref|XP_011621202.1| PREDICTED: protein VASCULAR ASSOCIATED DEATH... 97 7e-18 ref|XP_010919727.1| PREDICTED: GRAM domain-containing protein 1A... 97 7e-18 ref|XP_010919726.1| PREDICTED: GRAM domain-containing protein 1A... 97 7e-18 ref|XP_008232488.1| PREDICTED: GRAM domain-containing protein 1A... 97 7e-18 ref|XP_006837386.1| PREDICTED: protein VASCULAR ASSOCIATED DEATH... 97 7e-18 gb|KQL25841.1| hypothetical protein SETIT_029225mg [Setaria ital... 97 9e-18 gb|KQL25839.1| hypothetical protein SETIT_029225mg [Setaria ital... 97 9e-18 gb|EEC82066.1| hypothetical protein OsI_26056 [Oryza sativa Indi... 97 9e-18 ref|XP_004957739.1| PREDICTED: protein VASCULAR ASSOCIATED DEATH... 97 9e-18 ref|XP_008668425.1| PREDICTED: hypothetical protein isoform X1 [... 97 9e-18 ref|XP_002460718.1| hypothetical protein SORBIDRAFT_02g033690 [S... 97 9e-18 ref|XP_009373215.1| PREDICTED: GRAM domain-containing protein 1A... 97 1e-17 ref|XP_009373214.1| PREDICTED: GRAM domain-containing protein 1A... 97 1e-17 >ref|XP_008798798.1| PREDICTED: GRAM domain-containing protein 1A isoform X2 [Phoenix dactylifera] Length = 627 Score = 100 bits (250), Expect = 6e-19 Identities = 50/63 (79%), Positives = 53/63 (84%) Frame = -1 Query: 191 DVDILFSPSSPGYLKSEEYRLLFRLPSDEVLVQDFNCAFQENILLQGHMYLFVRHICFYS 12 DVD L S ++SEEYRLLFRLP DEVLVQDFNCA QENILLQGHMYLF+RHICFYS Sbjct: 52 DVDGLTQALS---MRSEEYRLLFRLPPDEVLVQDFNCALQENILLQGHMYLFIRHICFYS 108 Query: 11 NIF 3 NIF Sbjct: 109 NIF 111 >ref|XP_008798797.1| PREDICTED: GRAM domain-containing protein 1A isoform X1 [Phoenix dactylifera] Length = 636 Score = 100 bits (250), Expect = 6e-19 Identities = 50/63 (79%), Positives = 53/63 (84%) Frame = -1 Query: 191 DVDILFSPSSPGYLKSEEYRLLFRLPSDEVLVQDFNCAFQENILLQGHMYLFVRHICFYS 12 DVD L S ++SEEYRLLFRLP DEVLVQDFNCA QENILLQGHMYLF+RHICFYS Sbjct: 52 DVDGLTQALS---MRSEEYRLLFRLPPDEVLVQDFNCALQENILLQGHMYLFIRHICFYS 108 Query: 11 NIF 3 NIF Sbjct: 109 NIF 111 >ref|XP_010661402.1| PREDICTED: GRAM domain-containing protein 1A isoform X2 [Vitis vinifera] Length = 456 Score = 99.0 bits (245), Expect = 2e-18 Identities = 49/63 (77%), Positives = 54/63 (85%) Frame = -1 Query: 191 DVDILFSPSSPGYLKSEEYRLLFRLPSDEVLVQDFNCAFQENILLQGHMYLFVRHICFYS 12 DVD L SP++ LKSEEYR LFRLP +EVLVQDFNCA QE+IL QGHMYLFVR+ICFYS Sbjct: 51 DVDFLQSPAA---LKSEEYRQLFRLPLEEVLVQDFNCALQESILFQGHMYLFVRYICFYS 107 Query: 11 NIF 3 NIF Sbjct: 108 NIF 110 >ref|XP_002271102.1| PREDICTED: GRAM domain-containing protein 1A isoform X1 [Vitis vinifera] gi|297734616|emb|CBI16667.3| unnamed protein product [Vitis vinifera] Length = 639 Score = 99.0 bits (245), Expect = 2e-18 Identities = 49/63 (77%), Positives = 54/63 (85%) Frame = -1 Query: 191 DVDILFSPSSPGYLKSEEYRLLFRLPSDEVLVQDFNCAFQENILLQGHMYLFVRHICFYS 12 DVD L SP++ LKSEEYR LFRLP +EVLVQDFNCA QE+IL QGHMYLFVR+ICFYS Sbjct: 51 DVDFLQSPAA---LKSEEYRQLFRLPLEEVLVQDFNCALQESILFQGHMYLFVRYICFYS 107 Query: 11 NIF 3 NIF Sbjct: 108 NIF 110 >gb|EEE70134.1| hypothetical protein OsJ_30169 [Oryza sativa Japonica Group] Length = 545 Score = 98.6 bits (244), Expect = 3e-18 Identities = 48/57 (84%), Positives = 50/57 (87%), Gaps = 1/57 (1%) Frame = -1 Query: 170 PSSPGYL-KSEEYRLLFRLPSDEVLVQDFNCAFQENILLQGHMYLFVRHICFYSNIF 3 PSSP +SEEYRLLFRLP DEVLVQDFNCA QENILLQGHMYLF+ HICFYSNIF Sbjct: 62 PSSPLLASRSEEYRLLFRLPPDEVLVQDFNCALQENILLQGHMYLFLHHICFYSNIF 118 >ref|XP_010258771.1| PREDICTED: uncharacterized membrane protein C20F10.07-like [Nelumbo nucifera] Length = 647 Score = 98.2 bits (243), Expect = 4e-18 Identities = 49/63 (77%), Positives = 51/63 (80%) Frame = -1 Query: 191 DVDILFSPSSPGYLKSEEYRLLFRLPSDEVLVQDFNCAFQENILLQGHMYLFVRHICFYS 12 DV+I S L+SEEYR LFRLP DEVLVQDFNCA QENILLQGHMYLFV HICFYS Sbjct: 61 DVEI----QSAASLRSEEYRQLFRLPPDEVLVQDFNCALQENILLQGHMYLFVHHICFYS 116 Query: 11 NIF 3 NIF Sbjct: 117 NIF 119 >ref|XP_010238210.1| PREDICTED: uncharacterized membrane protein C20F10.07 [Brachypodium distachyon] gi|944080826|gb|KQK16178.1| hypothetical protein BRADI_1g27237 [Brachypodium distachyon] Length = 624 Score = 97.8 bits (242), Expect = 5e-18 Identities = 47/57 (82%), Positives = 50/57 (87%), Gaps = 1/57 (1%) Frame = -1 Query: 170 PSSPGYL-KSEEYRLLFRLPSDEVLVQDFNCAFQENILLQGHMYLFVRHICFYSNIF 3 PSSP +SEEYRL+FRLP DEVLVQDFNCA QENILLQGHMYLF+ HICFYSNIF Sbjct: 58 PSSPLLASRSEEYRLMFRLPPDEVLVQDFNCALQENILLQGHMYLFLHHICFYSNIF 114 >ref|XP_011621202.1| PREDICTED: protein VASCULAR ASSOCIATED DEATH 1, chloroplastic isoform X2 [Amborella trichopoda] Length = 599 Score = 97.4 bits (241), Expect = 7e-18 Identities = 43/49 (87%), Positives = 47/49 (95%) Frame = -1 Query: 149 KSEEYRLLFRLPSDEVLVQDFNCAFQENILLQGHMYLFVRHICFYSNIF 3 +SEEYRLLF LP++EVLVQDFNCAFQENILLQGHMYLFV H+CFYSNIF Sbjct: 54 RSEEYRLLFHLPAEEVLVQDFNCAFQENILLQGHMYLFVHHVCFYSNIF 102 >ref|XP_010919727.1| PREDICTED: GRAM domain-containing protein 1A isoform X2 [Elaeis guineensis] Length = 604 Score = 97.4 bits (241), Expect = 7e-18 Identities = 48/63 (76%), Positives = 51/63 (80%) Frame = -1 Query: 191 DVDILFSPSSPGYLKSEEYRLLFRLPSDEVLVQDFNCAFQENILLQGHMYLFVRHICFYS 12 DVD L S +SEEYRLLFRLP+DEVLVQDFNCA QEN LLQGHMYLF+ HICFYS Sbjct: 52 DVDSLTQVLST---RSEEYRLLFRLPTDEVLVQDFNCALQENFLLQGHMYLFIHHICFYS 108 Query: 11 NIF 3 NIF Sbjct: 109 NIF 111 >ref|XP_010919726.1| PREDICTED: GRAM domain-containing protein 1A isoform X1 [Elaeis guineensis] Length = 636 Score = 97.4 bits (241), Expect = 7e-18 Identities = 48/63 (76%), Positives = 51/63 (80%) Frame = -1 Query: 191 DVDILFSPSSPGYLKSEEYRLLFRLPSDEVLVQDFNCAFQENILLQGHMYLFVRHICFYS 12 DVD L S +SEEYRLLFRLP+DEVLVQDFNCA QEN LLQGHMYLF+ HICFYS Sbjct: 52 DVDSLTQVLST---RSEEYRLLFRLPTDEVLVQDFNCALQENFLLQGHMYLFIHHICFYS 108 Query: 11 NIF 3 NIF Sbjct: 109 NIF 111 >ref|XP_008232488.1| PREDICTED: GRAM domain-containing protein 1A [Prunus mume] Length = 647 Score = 97.4 bits (241), Expect = 7e-18 Identities = 43/56 (76%), Positives = 48/56 (85%) Frame = -1 Query: 170 PSSPGYLKSEEYRLLFRLPSDEVLVQDFNCAFQENILLQGHMYLFVRHICFYSNIF 3 P S LKSEEYR LFRLP DE L++DFNCAFQENIL+QGHMYLF+ +ICFYSNIF Sbjct: 64 PQSAASLKSEEYRQLFRLPPDEALIEDFNCAFQENILIQGHMYLFIHYICFYSNIF 119 >ref|XP_006837386.1| PREDICTED: protein VASCULAR ASSOCIATED DEATH 1, chloroplastic isoform X1 [Amborella trichopoda] gi|548840004|gb|ERN00240.1| hypothetical protein AMTR_s00111p00128560 [Amborella trichopoda] Length = 622 Score = 97.4 bits (241), Expect = 7e-18 Identities = 43/49 (87%), Positives = 47/49 (95%) Frame = -1 Query: 149 KSEEYRLLFRLPSDEVLVQDFNCAFQENILLQGHMYLFVRHICFYSNIF 3 +SEEYRLLF LP++EVLVQDFNCAFQENILLQGHMYLFV H+CFYSNIF Sbjct: 54 RSEEYRLLFHLPAEEVLVQDFNCAFQENILLQGHMYLFVHHVCFYSNIF 102 >gb|KQL25841.1| hypothetical protein SETIT_029225mg [Setaria italica] Length = 473 Score = 97.1 bits (240), Expect = 9e-18 Identities = 44/49 (89%), Positives = 46/49 (93%) Frame = -1 Query: 149 KSEEYRLLFRLPSDEVLVQDFNCAFQENILLQGHMYLFVRHICFYSNIF 3 +SEEYRLLFRLP DEVLVQDFNCA QENILLQGHMYLF+ HICFYSNIF Sbjct: 68 RSEEYRLLFRLPPDEVLVQDFNCALQENILLQGHMYLFLHHICFYSNIF 116 >gb|KQL25839.1| hypothetical protein SETIT_029225mg [Setaria italica] Length = 391 Score = 97.1 bits (240), Expect = 9e-18 Identities = 44/49 (89%), Positives = 46/49 (93%) Frame = -1 Query: 149 KSEEYRLLFRLPSDEVLVQDFNCAFQENILLQGHMYLFVRHICFYSNIF 3 +SEEYRLLFRLP DEVLVQDFNCA QENILLQGHMYLF+ HICFYSNIF Sbjct: 68 RSEEYRLLFRLPPDEVLVQDFNCALQENILLQGHMYLFLHHICFYSNIF 116 >gb|EEC82066.1| hypothetical protein OsI_26056 [Oryza sativa Indica Group] Length = 563 Score = 97.1 bits (240), Expect = 9e-18 Identities = 44/49 (89%), Positives = 46/49 (93%) Frame = -1 Query: 149 KSEEYRLLFRLPSDEVLVQDFNCAFQENILLQGHMYLFVRHICFYSNIF 3 +SEEYRLLFRLP DEVLVQDFNCA QENILLQGHMYLF+ HICFYSNIF Sbjct: 59 RSEEYRLLFRLPPDEVLVQDFNCALQENILLQGHMYLFLHHICFYSNIF 107 >ref|XP_004957739.1| PREDICTED: protein VASCULAR ASSOCIATED DEATH 1, chloroplastic [Setaria italica] gi|944261583|gb|KQL25840.1| hypothetical protein SETIT_029225mg [Setaria italica] Length = 620 Score = 97.1 bits (240), Expect = 9e-18 Identities = 44/49 (89%), Positives = 46/49 (93%) Frame = -1 Query: 149 KSEEYRLLFRLPSDEVLVQDFNCAFQENILLQGHMYLFVRHICFYSNIF 3 +SEEYRLLFRLP DEVLVQDFNCA QENILLQGHMYLF+ HICFYSNIF Sbjct: 68 RSEEYRLLFRLPPDEVLVQDFNCALQENILLQGHMYLFLHHICFYSNIF 116 >ref|XP_008668425.1| PREDICTED: hypothetical protein isoform X1 [Zea mays] gi|414590305|tpg|DAA40876.1| TPA: hypothetical protein ZEAMMB73_978197 [Zea mays] Length = 623 Score = 97.1 bits (240), Expect = 9e-18 Identities = 44/49 (89%), Positives = 46/49 (93%) Frame = -1 Query: 149 KSEEYRLLFRLPSDEVLVQDFNCAFQENILLQGHMYLFVRHICFYSNIF 3 +SEEYRLLFRLP DEVLVQDFNCA QENILLQGHMYLF+ HICFYSNIF Sbjct: 68 RSEEYRLLFRLPPDEVLVQDFNCALQENILLQGHMYLFLHHICFYSNIF 116 >ref|XP_002460718.1| hypothetical protein SORBIDRAFT_02g033690 [Sorghum bicolor] gi|241924095|gb|EER97239.1| hypothetical protein SORBIDRAFT_02g033690 [Sorghum bicolor] Length = 569 Score = 97.1 bits (240), Expect = 9e-18 Identities = 44/49 (89%), Positives = 46/49 (93%) Frame = -1 Query: 149 KSEEYRLLFRLPSDEVLVQDFNCAFQENILLQGHMYLFVRHICFYSNIF 3 +SEEYRLLFRLP DEVLVQDFNCA QENILLQGHMYLF+ HICFYSNIF Sbjct: 70 RSEEYRLLFRLPPDEVLVQDFNCALQENILLQGHMYLFLHHICFYSNIF 118 >ref|XP_009373215.1| PREDICTED: GRAM domain-containing protein 1A-like isoform X2 [Pyrus x bretschneideri] Length = 642 Score = 96.7 bits (239), Expect = 1e-17 Identities = 44/54 (81%), Positives = 48/54 (88%) Frame = -1 Query: 164 SPGYLKSEEYRLLFRLPSDEVLVQDFNCAFQENILLQGHMYLFVRHICFYSNIF 3 S LKSEEYR LFRLP DEVL++DFNCAFQENIL+QGHMYLFV +ICFYSNIF Sbjct: 68 SAASLKSEEYRQLFRLPPDEVLIEDFNCAFQENILIQGHMYLFVHYICFYSNIF 121 >ref|XP_009373214.1| PREDICTED: GRAM domain-containing protein 1A-like isoform X1 [Pyrus x bretschneideri] Length = 644 Score = 96.7 bits (239), Expect = 1e-17 Identities = 44/54 (81%), Positives = 48/54 (88%) Frame = -1 Query: 164 SPGYLKSEEYRLLFRLPSDEVLVQDFNCAFQENILLQGHMYLFVRHICFYSNIF 3 S LKSEEYR LFRLP DEVL++DFNCAFQENIL+QGHMYLFV +ICFYSNIF Sbjct: 68 SAASLKSEEYRQLFRLPPDEVLIEDFNCAFQENILIQGHMYLFVHYICFYSNIF 121