BLASTX nr result
ID: Papaver30_contig00036093
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver30_contig00036093 (479 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006362022.1| PREDICTED: purple acid phosphatase 2-like [S... 59 1e-06 ref|XP_002306126.2| Fe(III)-Zn(II) purple acid phosphatase famil... 57 4e-06 ref|XP_002264113.1| PREDICTED: purple acid phosphatase [Vitis vi... 57 4e-06 dbj|BAO58596.1| purple acid phosphatase [Populus nigra] 57 5e-06 ref|XP_002313026.2| hypothetical protein POPTR_0009s12400g [Popu... 57 7e-06 >ref|XP_006362022.1| PREDICTED: purple acid phosphatase 2-like [Solanum tuberosum] Length = 465 Score = 59.3 bits (142), Expect = 1e-06 Identities = 28/42 (66%), Positives = 35/42 (83%), Gaps = 2/42 (4%) Frame = -1 Query: 122 MGLFS--LFVTLFLILNVAVICHGGITSKFVRKVDKTIDMPL 3 MG+F +FV L LI+N +V+CHGG+TS FVRKV+KTIDMPL Sbjct: 1 MGVFGYCIFVVLSLIVNESVLCHGGVTSSFVRKVEKTIDMPL 42 >ref|XP_002306126.2| Fe(III)-Zn(II) purple acid phosphatase family protein [Populus trichocarpa] gi|550341184|gb|EEE86637.2| Fe(III)-Zn(II) purple acid phosphatase family protein [Populus trichocarpa] Length = 490 Score = 57.4 bits (137), Expect = 4e-06 Identities = 25/35 (71%), Positives = 29/35 (82%) Frame = -1 Query: 107 LFVTLFLILNVAVICHGGITSKFVRKVDKTIDMPL 3 +F LFL+ N AV+CHGG TS FVRKV+KTIDMPL Sbjct: 33 VFAVLFLVFNAAVLCHGGKTSSFVRKVEKTIDMPL 67 >ref|XP_002264113.1| PREDICTED: purple acid phosphatase [Vitis vinifera] Length = 472 Score = 57.4 bits (137), Expect = 4e-06 Identities = 25/36 (69%), Positives = 31/36 (86%) Frame = -1 Query: 110 SLFVTLFLILNVAVICHGGITSKFVRKVDKTIDMPL 3 ++ + L L+LN AV+CHGGITS FVRKV+KTIDMPL Sbjct: 14 TVVIVLGLVLNAAVVCHGGITSSFVRKVEKTIDMPL 49 >dbj|BAO58596.1| purple acid phosphatase [Populus nigra] Length = 468 Score = 57.0 bits (136), Expect = 5e-06 Identities = 25/35 (71%), Positives = 29/35 (82%) Frame = -1 Query: 107 LFVTLFLILNVAVICHGGITSKFVRKVDKTIDMPL 3 +F LFLILN V+CHGG TS FVRKV+KT+DMPL Sbjct: 11 VFAVLFLILNAPVLCHGGKTSSFVRKVEKTVDMPL 45 >ref|XP_002313026.2| hypothetical protein POPTR_0009s12400g [Populus trichocarpa] gi|550331584|gb|EEE86981.2| hypothetical protein POPTR_0009s12400g [Populus trichocarpa] Length = 489 Score = 56.6 bits (135), Expect = 7e-06 Identities = 24/35 (68%), Positives = 29/35 (82%) Frame = -1 Query: 107 LFVTLFLILNVAVICHGGITSKFVRKVDKTIDMPL 3 +F LFL+LN V+CHGG TS FVRKV+KT+DMPL Sbjct: 32 VFAVLFLVLNAPVLCHGGKTSSFVRKVEKTVDMPL 66