BLASTX nr result
ID: Papaver30_contig00034985
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver30_contig00034985 (429 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011470887.1| PREDICTED: ubiquitin carboxyl-terminal hydro... 59 1e-06 ref|XP_012439858.1| PREDICTED: ubiquitin carboxyl-terminal hydro... 59 2e-06 gb|KJB52399.1| hypothetical protein B456_008G259900 [Gossypium r... 57 7e-06 ref|XP_012439859.1| PREDICTED: ubiquitin carboxyl-terminal hydro... 57 7e-06 gb|KHF99211.1| Ubiquitin carboxyl-terminal hydrolase 9 -like pro... 57 7e-06 >ref|XP_011470887.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 9 isoform X1 [Fragaria vesca subsp. vesca] Length = 927 Score = 58.9 bits (141), Expect = 1e-06 Identities = 25/34 (73%), Positives = 31/34 (91%) Frame = +2 Query: 326 MTIPESGCYMDNETSCLPCTPEEEKRVVDELTKE 427 MTIP+SG M+NETSCLP TPEEEKR++DELT++ Sbjct: 1 MTIPDSGFMMENETSCLPHTPEEEKRIIDELTRQ 34 >ref|XP_012439858.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 9-like isoform X1 [Gossypium raimondii] Length = 960 Score = 58.5 bits (140), Expect = 2e-06 Identities = 25/44 (56%), Positives = 32/44 (72%) Frame = +2 Query: 296 VKLKGNLENTMTIPESGCYMDNETSCLPCTPEEEKRVVDELTKE 427 V+ G + MTIP+SGC M+N SCLPCTPEEEK++V +L E Sbjct: 25 VEKTGGNSSIMTIPDSGCVMENGASCLPCTPEEEKKIVTDLRNE 68 >gb|KJB52399.1| hypothetical protein B456_008G259900 [Gossypium raimondii] Length = 874 Score = 56.6 bits (135), Expect = 7e-06 Identities = 23/34 (67%), Positives = 28/34 (82%) Frame = +2 Query: 326 MTIPESGCYMDNETSCLPCTPEEEKRVVDELTKE 427 MTIP+SGC M+N SCLPCTPEEEK++V +L E Sbjct: 1 MTIPDSGCVMENGASCLPCTPEEEKKIVTDLRNE 34 >ref|XP_012439859.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 9-like isoform X2 [Gossypium raimondii] gi|763785326|gb|KJB52397.1| hypothetical protein B456_008G259900 [Gossypium raimondii] Length = 926 Score = 56.6 bits (135), Expect = 7e-06 Identities = 23/34 (67%), Positives = 28/34 (82%) Frame = +2 Query: 326 MTIPESGCYMDNETSCLPCTPEEEKRVVDELTKE 427 MTIP+SGC M+N SCLPCTPEEEK++V +L E Sbjct: 1 MTIPDSGCVMENGASCLPCTPEEEKKIVTDLRNE 34 >gb|KHF99211.1| Ubiquitin carboxyl-terminal hydrolase 9 -like protein [Gossypium arboreum] Length = 926 Score = 56.6 bits (135), Expect = 7e-06 Identities = 23/34 (67%), Positives = 28/34 (82%) Frame = +2 Query: 326 MTIPESGCYMDNETSCLPCTPEEEKRVVDELTKE 427 MTIP+SGC M+N SCLPCTPEEEK++V +L E Sbjct: 1 MTIPDSGCVMENGASCLPCTPEEEKKIVTDLRNE 34