BLASTX nr result
ID: Papaver30_contig00033811
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver30_contig00033811 (1229 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010275173.1| PREDICTED: pentatricopeptide repeat-containi... 75 9e-11 ref|XP_009773682.1| PREDICTED: pentatricopeptide repeat-containi... 72 7e-10 ref|XP_009773680.1| PREDICTED: pentatricopeptide repeat-containi... 72 7e-10 ref|XP_009773679.1| PREDICTED: pentatricopeptide repeat-containi... 72 7e-10 ref|XP_009592015.1| PREDICTED: pentatricopeptide repeat-containi... 72 7e-10 ref|XP_009592011.1| PREDICTED: pentatricopeptide repeat-containi... 72 7e-10 emb|CDP11622.1| unnamed protein product [Coffea canephora] 72 7e-10 ref|XP_007029495.1| Pentatricopeptide repeat-containing protein,... 72 1e-09 ref|XP_012459106.1| PREDICTED: pentatricopeptide repeat-containi... 72 1e-09 ref|XP_012459104.1| PREDICTED: pentatricopeptide repeat-containi... 72 1e-09 gb|KJB76398.1| hypothetical protein B456_012G086600 [Gossypium r... 72 1e-09 gb|KJB76397.1| hypothetical protein B456_012G086600 [Gossypium r... 72 1e-09 ref|XP_012459103.1| PREDICTED: pentatricopeptide repeat-containi... 72 1e-09 ref|XP_012459102.1| PREDICTED: pentatricopeptide repeat-containi... 72 1e-09 gb|KHG03831.1| hypothetical protein F383_26634 [Gossypium arboreum] 72 1e-09 gb|KHG03829.1| hypothetical protein F383_26634 [Gossypium arboreum] 72 1e-09 gb|KHG03828.1| hypothetical protein F383_26634 [Gossypium arboreum] 72 1e-09 ref|XP_004249757.1| PREDICTED: pentatricopeptide repeat-containi... 72 1e-09 ref|XP_006850860.2| PREDICTED: pentatricopeptide repeat-containi... 71 2e-09 ref|XP_006351327.1| PREDICTED: pentatricopeptide repeat-containi... 71 2e-09 >ref|XP_010275173.1| PREDICTED: pentatricopeptide repeat-containing protein At5g42310, mitochondrial-like [Nelumbo nucifera] Length = 536 Score = 75.5 bits (184), Expect = 9e-11 Identities = 36/48 (75%), Positives = 42/48 (87%) Frame = -1 Query: 1229 LMKAFIRAKKFDQVLGIYEEMQSAGCTPDRKARELLQTASGVLEKRQG 1086 LMKAFIRA+KFDQV GIY+EM+ AGCTPDR+ARE+LQ A VLE+R G Sbjct: 478 LMKAFIRARKFDQVPGIYKEMECAGCTPDRRAREMLQNALMVLEQRHG 525 >ref|XP_009773682.1| PREDICTED: pentatricopeptide repeat-containing protein At5g42310, mitochondrial-like isoform X3 [Nicotiana sylvestris] Length = 378 Score = 72.4 bits (176), Expect = 7e-10 Identities = 35/46 (76%), Positives = 41/46 (89%) Frame = -1 Query: 1229 LMKAFIRAKKFDQVLGIYEEMQSAGCTPDRKARELLQTASGVLEKR 1092 LMKAF+RAKKFDQV IY EM+SAGCTPDRKARE+LQ+A +LE+R Sbjct: 331 LMKAFMRAKKFDQVPKIYSEMESAGCTPDRKAREVLQSALMILEQR 376 >ref|XP_009773680.1| PREDICTED: pentatricopeptide repeat-containing protein At5g42310, mitochondrial-like isoform X2 [Nicotiana sylvestris] gi|698567110|ref|XP_009773681.1| PREDICTED: pentatricopeptide repeat-containing protein At5g42310, mitochondrial-like isoform X2 [Nicotiana sylvestris] Length = 523 Score = 72.4 bits (176), Expect = 7e-10 Identities = 35/46 (76%), Positives = 41/46 (89%) Frame = -1 Query: 1229 LMKAFIRAKKFDQVLGIYEEMQSAGCTPDRKARELLQTASGVLEKR 1092 LMKAF+RAKKFDQV IY EM+SAGCTPDRKARE+LQ+A +LE+R Sbjct: 476 LMKAFMRAKKFDQVPKIYSEMESAGCTPDRKAREVLQSALMILEQR 521 >ref|XP_009773679.1| PREDICTED: pentatricopeptide repeat-containing protein At5g42310, mitochondrial-like isoform X1 [Nicotiana sylvestris] Length = 560 Score = 72.4 bits (176), Expect = 7e-10 Identities = 35/46 (76%), Positives = 41/46 (89%) Frame = -1 Query: 1229 LMKAFIRAKKFDQVLGIYEEMQSAGCTPDRKARELLQTASGVLEKR 1092 LMKAF+RAKKFDQV IY EM+SAGCTPDRKARE+LQ+A +LE+R Sbjct: 513 LMKAFMRAKKFDQVPKIYSEMESAGCTPDRKAREVLQSALMILEQR 558 >ref|XP_009592015.1| PREDICTED: pentatricopeptide repeat-containing protein At5g42310, mitochondrial-like isoform X3 [Nicotiana tomentosiformis] Length = 378 Score = 72.4 bits (176), Expect = 7e-10 Identities = 35/46 (76%), Positives = 41/46 (89%) Frame = -1 Query: 1229 LMKAFIRAKKFDQVLGIYEEMQSAGCTPDRKARELLQTASGVLEKR 1092 LMKAF+RAKKFDQV IY EM+SAGCTPDRKARE+LQ+A +LE+R Sbjct: 331 LMKAFMRAKKFDQVPKIYSEMESAGCTPDRKAREVLQSALMILEQR 376 >ref|XP_009592011.1| PREDICTED: pentatricopeptide repeat-containing protein At5g42310, mitochondrial-like isoform X1 [Nicotiana tomentosiformis] gi|697166361|ref|XP_009592012.1| PREDICTED: pentatricopeptide repeat-containing protein At5g42310, mitochondrial-like isoform X1 [Nicotiana tomentosiformis] gi|697166363|ref|XP_009592013.1| PREDICTED: pentatricopeptide repeat-containing protein At5g42310, mitochondrial-like isoform X1 [Nicotiana tomentosiformis] Length = 523 Score = 72.4 bits (176), Expect = 7e-10 Identities = 35/46 (76%), Positives = 41/46 (89%) Frame = -1 Query: 1229 LMKAFIRAKKFDQVLGIYEEMQSAGCTPDRKARELLQTASGVLEKR 1092 LMKAF+RAKKFDQV IY EM+SAGCTPDRKARE+LQ+A +LE+R Sbjct: 476 LMKAFMRAKKFDQVPKIYSEMESAGCTPDRKAREVLQSALMILEQR 521 >emb|CDP11622.1| unnamed protein product [Coffea canephora] Length = 555 Score = 72.4 bits (176), Expect = 7e-10 Identities = 35/46 (76%), Positives = 40/46 (86%) Frame = -1 Query: 1229 LMKAFIRAKKFDQVLGIYEEMQSAGCTPDRKARELLQTASGVLEKR 1092 LMKAFIRAKKFDQV IY+EM+ AGCTPDRKARE+LQ A VL++R Sbjct: 501 LMKAFIRAKKFDQVPSIYKEMEYAGCTPDRKAREMLQAAEMVLQQR 546 >ref|XP_007029495.1| Pentatricopeptide repeat-containing protein, putative isoform 1 [Theobroma cacao] gi|508718100|gb|EOY09997.1| Pentatricopeptide repeat-containing protein, putative isoform 1 [Theobroma cacao] Length = 513 Score = 72.0 bits (175), Expect = 1e-09 Identities = 35/46 (76%), Positives = 41/46 (89%) Frame = -1 Query: 1229 LMKAFIRAKKFDQVLGIYEEMQSAGCTPDRKARELLQTASGVLEKR 1092 LMKAFIRAKKFD+V IY EM+S+GCTPDRKAR++LQTA VLE+R Sbjct: 467 LMKAFIRAKKFDRVPEIYREMESSGCTPDRKARQMLQTALMVLEQR 512 >ref|XP_012459106.1| PREDICTED: pentatricopeptide repeat-containing protein At5g42310, mitochondrial-like isoform X4 [Gossypium raimondii] Length = 485 Score = 71.6 bits (174), Expect = 1e-09 Identities = 35/46 (76%), Positives = 41/46 (89%) Frame = -1 Query: 1229 LMKAFIRAKKFDQVLGIYEEMQSAGCTPDRKARELLQTASGVLEKR 1092 LMKAFIRAKKFD+V IY+EM+S GCTPDRKAR++LQTA VLE+R Sbjct: 436 LMKAFIRAKKFDKVPEIYKEMESYGCTPDRKARQMLQTALMVLERR 481 >ref|XP_012459104.1| PREDICTED: pentatricopeptide repeat-containing protein At5g42310, mitochondrial-like isoform X3 [Gossypium raimondii] gi|823252980|ref|XP_012459105.1| PREDICTED: pentatricopeptide repeat-containing protein At5g42310, mitochondrial-like isoform X3 [Gossypium raimondii] Length = 490 Score = 71.6 bits (174), Expect = 1e-09 Identities = 35/46 (76%), Positives = 41/46 (89%) Frame = -1 Query: 1229 LMKAFIRAKKFDQVLGIYEEMQSAGCTPDRKARELLQTASGVLEKR 1092 LMKAFIRAKKFD+V IY+EM+S GCTPDRKAR++LQTA VLE+R Sbjct: 441 LMKAFIRAKKFDKVPEIYKEMESYGCTPDRKARQMLQTALMVLERR 486 >gb|KJB76398.1| hypothetical protein B456_012G086600 [Gossypium raimondii] Length = 487 Score = 71.6 bits (174), Expect = 1e-09 Identities = 35/46 (76%), Positives = 41/46 (89%) Frame = -1 Query: 1229 LMKAFIRAKKFDQVLGIYEEMQSAGCTPDRKARELLQTASGVLEKR 1092 LMKAFIRAKKFD+V IY+EM+S GCTPDRKAR++LQTA VLE+R Sbjct: 441 LMKAFIRAKKFDKVPEIYKEMESYGCTPDRKARQMLQTALMVLERR 486 >gb|KJB76397.1| hypothetical protein B456_012G086600 [Gossypium raimondii] Length = 482 Score = 71.6 bits (174), Expect = 1e-09 Identities = 35/46 (76%), Positives = 41/46 (89%) Frame = -1 Query: 1229 LMKAFIRAKKFDQVLGIYEEMQSAGCTPDRKARELLQTASGVLEKR 1092 LMKAFIRAKKFD+V IY+EM+S GCTPDRKAR++LQTA VLE+R Sbjct: 436 LMKAFIRAKKFDKVPEIYKEMESYGCTPDRKARQMLQTALMVLERR 481 >ref|XP_012459103.1| PREDICTED: pentatricopeptide repeat-containing protein At5g42310, mitochondrial-like isoform X2 [Gossypium raimondii] gi|763809494|gb|KJB76396.1| hypothetical protein B456_012G086600 [Gossypium raimondii] Length = 511 Score = 71.6 bits (174), Expect = 1e-09 Identities = 35/46 (76%), Positives = 41/46 (89%) Frame = -1 Query: 1229 LMKAFIRAKKFDQVLGIYEEMQSAGCTPDRKARELLQTASGVLEKR 1092 LMKAFIRAKKFD+V IY+EM+S GCTPDRKAR++LQTA VLE+R Sbjct: 465 LMKAFIRAKKFDKVPEIYKEMESYGCTPDRKARQMLQTALMVLERR 510 >ref|XP_012459102.1| PREDICTED: pentatricopeptide repeat-containing protein At5g42310, mitochondrial-like isoform X1 [Gossypium raimondii] gi|763809493|gb|KJB76395.1| hypothetical protein B456_012G086600 [Gossypium raimondii] Length = 514 Score = 71.6 bits (174), Expect = 1e-09 Identities = 35/46 (76%), Positives = 41/46 (89%) Frame = -1 Query: 1229 LMKAFIRAKKFDQVLGIYEEMQSAGCTPDRKARELLQTASGVLEKR 1092 LMKAFIRAKKFD+V IY+EM+S GCTPDRKAR++LQTA VLE+R Sbjct: 465 LMKAFIRAKKFDKVPEIYKEMESYGCTPDRKARQMLQTALMVLERR 510 >gb|KHG03831.1| hypothetical protein F383_26634 [Gossypium arboreum] Length = 511 Score = 71.6 bits (174), Expect = 1e-09 Identities = 35/46 (76%), Positives = 41/46 (89%) Frame = -1 Query: 1229 LMKAFIRAKKFDQVLGIYEEMQSAGCTPDRKARELLQTASGVLEKR 1092 LMKAFIRAKKFD+V IY+EM+S GCTPDRKAR++LQTA VLE+R Sbjct: 465 LMKAFIRAKKFDKVPEIYKEMESYGCTPDRKARQMLQTALMVLERR 510 >gb|KHG03829.1| hypothetical protein F383_26634 [Gossypium arboreum] Length = 1628 Score = 71.6 bits (174), Expect = 1e-09 Identities = 35/46 (76%), Positives = 41/46 (89%) Frame = -1 Query: 1229 LMKAFIRAKKFDQVLGIYEEMQSAGCTPDRKARELLQTASGVLEKR 1092 LMKAFIRAKKFD+V IY+EM+S GCTPDRKAR++LQTA VLE+R Sbjct: 465 LMKAFIRAKKFDKVPEIYKEMESYGCTPDRKARQMLQTALMVLERR 510 >gb|KHG03828.1| hypothetical protein F383_26634 [Gossypium arboreum] Length = 1639 Score = 71.6 bits (174), Expect = 1e-09 Identities = 35/46 (76%), Positives = 41/46 (89%) Frame = -1 Query: 1229 LMKAFIRAKKFDQVLGIYEEMQSAGCTPDRKARELLQTASGVLEKR 1092 LMKAFIRAKKFD+V IY+EM+S GCTPDRKAR++LQTA VLE+R Sbjct: 465 LMKAFIRAKKFDKVPEIYKEMESYGCTPDRKARQMLQTALMVLERR 510 >ref|XP_004249757.1| PREDICTED: pentatricopeptide repeat-containing protein At5g42310, mitochondrial-like [Solanum lycopersicum] gi|723738498|ref|XP_010312136.1| PREDICTED: pentatricopeptide repeat-containing protein At5g42310, mitochondrial-like [Solanum lycopersicum] gi|723738501|ref|XP_010312137.1| PREDICTED: pentatricopeptide repeat-containing protein At5g42310, mitochondrial-like [Solanum lycopersicum] gi|723738504|ref|XP_010312138.1| PREDICTED: pentatricopeptide repeat-containing protein At5g42310, mitochondrial-like [Solanum lycopersicum] gi|723738507|ref|XP_010312139.1| PREDICTED: pentatricopeptide repeat-containing protein At5g42310, mitochondrial-like [Solanum lycopersicum] gi|723738510|ref|XP_010312140.1| PREDICTED: pentatricopeptide repeat-containing protein At5g42310, mitochondrial-like [Solanum lycopersicum] gi|723738513|ref|XP_010312142.1| PREDICTED: pentatricopeptide repeat-containing protein At5g42310, mitochondrial-like [Solanum lycopersicum] Length = 523 Score = 71.6 bits (174), Expect = 1e-09 Identities = 34/46 (73%), Positives = 40/46 (86%) Frame = -1 Query: 1229 LMKAFIRAKKFDQVLGIYEEMQSAGCTPDRKARELLQTASGVLEKR 1092 LMKAF+RAKKFDQV IY EM+S GCTPDRKARE+LQ+A +LE+R Sbjct: 476 LMKAFLRAKKFDQVPKIYSEMESTGCTPDRKAREMLQSALMILEQR 521 >ref|XP_006850860.2| PREDICTED: pentatricopeptide repeat-containing protein At5g42310, mitochondrial [Amborella trichopoda] Length = 492 Score = 71.2 bits (173), Expect = 2e-09 Identities = 33/48 (68%), Positives = 40/48 (83%) Frame = -1 Query: 1229 LMKAFIRAKKFDQVLGIYEEMQSAGCTPDRKARELLQTASGVLEKRQG 1086 LMKAF RA+KFDQV +Y+EM+SAGC PDRKARE+LQ A +LE+R G Sbjct: 442 LMKAFFRARKFDQVQEVYKEMESAGCVPDRKAREMLQNALLILEQRHG 489 >ref|XP_006351327.1| PREDICTED: pentatricopeptide repeat-containing protein At5g42310, mitochondrial-like isoform X1 [Solanum tuberosum] gi|565369409|ref|XP_006351328.1| PREDICTED: pentatricopeptide repeat-containing protein At5g42310, mitochondrial-like isoform X2 [Solanum tuberosum] gi|565369411|ref|XP_006351329.1| PREDICTED: pentatricopeptide repeat-containing protein At5g42310, mitochondrial-like isoform X3 [Solanum tuberosum] Length = 523 Score = 71.2 bits (173), Expect = 2e-09 Identities = 34/46 (73%), Positives = 40/46 (86%) Frame = -1 Query: 1229 LMKAFIRAKKFDQVLGIYEEMQSAGCTPDRKARELLQTASGVLEKR 1092 LMKAF+RAKKFDQV IY EM+S GCTPDRKARE+LQ+A +LE+R Sbjct: 476 LMKAFMRAKKFDQVPKIYSEMESTGCTPDRKAREMLQSALMILEQR 521