BLASTX nr result
ID: Papaver30_contig00033576
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver30_contig00033576 (462 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012065867.1| PREDICTED: calcium-dependent protein kinase ... 70 5e-10 gb|KDP43197.1| hypothetical protein JCGZ_22749 [Jatropha curcas] 70 5e-10 ref|XP_004140192.1| PREDICTED: calcium-dependent protein kinase ... 69 1e-09 ref|XP_010247475.1| PREDICTED: calcium-dependent protein kinase ... 69 1e-09 ref|XP_008449648.1| PREDICTED: calcium-dependent protein kinase ... 69 1e-09 ref|XP_012465908.1| PREDICTED: calcium-dependent protein kinase ... 68 3e-09 emb|CBI24256.3| unnamed protein product [Vitis vinifera] 68 3e-09 ref|XP_002276630.2| PREDICTED: calcium-dependent protein kinase ... 68 3e-09 ref|XP_003568203.1| PREDICTED: calcium-dependent protein kinase ... 68 3e-09 emb|CAN62888.1| hypothetical protein VITISV_025544 [Vitis vinifera] 68 3e-09 ref|XP_007015253.1| Calcium-dependent protein kinase 17 [Theobro... 67 4e-09 ref|XP_002299975.2| hypothetical protein POPTR_0001s28150g [Popu... 67 5e-09 ref|XP_009419685.1| PREDICTED: calcium-dependent protein kinase ... 67 7e-09 ref|XP_006845045.1| PREDICTED: calcium-dependent protein kinase ... 67 7e-09 ref|XP_009404695.1| PREDICTED: calcium-dependent protein kinase ... 66 9e-09 ref|XP_002526062.1| calcium-dependent protein kinase, putative [... 66 9e-09 ref|XP_010106395.1| Calcium-dependent protein kinase 17 [Morus n... 66 1e-08 ref|XP_009412989.1| PREDICTED: calcium-dependent protein kinase ... 66 1e-08 ref|XP_008365176.1| PREDICTED: calcium-dependent protein kinase ... 66 1e-08 ref|XP_010031714.1| PREDICTED: calcium-dependent protein kinase ... 66 1e-08 >ref|XP_012065867.1| PREDICTED: calcium-dependent protein kinase 34 [Jatropha curcas] Length = 538 Score = 70.5 bits (171), Expect = 5e-10 Identities = 32/34 (94%), Positives = 32/34 (94%) Frame = -1 Query: 462 VGGDNDGRINYDEFVAMMRKGNPEANPKKRRDVV 361 V GDNDGRINYDEFVAMMRKGNPEANPKKRRD V Sbjct: 503 VDGDNDGRINYDEFVAMMRKGNPEANPKKRRDTV 536 >gb|KDP43197.1| hypothetical protein JCGZ_22749 [Jatropha curcas] Length = 531 Score = 70.5 bits (171), Expect = 5e-10 Identities = 32/34 (94%), Positives = 32/34 (94%) Frame = -1 Query: 462 VGGDNDGRINYDEFVAMMRKGNPEANPKKRRDVV 361 V GDNDGRINYDEFVAMMRKGNPEANPKKRRD V Sbjct: 496 VDGDNDGRINYDEFVAMMRKGNPEANPKKRRDTV 529 >ref|XP_004140192.1| PREDICTED: calcium-dependent protein kinase 34 [Cucumis sativus] gi|700192889|gb|KGN48093.1| hypothetical protein Csa_6G430690 [Cucumis sativus] Length = 535 Score = 69.3 bits (168), Expect = 1e-09 Identities = 31/35 (88%), Positives = 32/35 (91%) Frame = -1 Query: 462 VGGDNDGRINYDEFVAMMRKGNPEANPKKRRDVVI 358 V GDNDG INYDEFVAMMRKGNPEANPKKRRDV + Sbjct: 501 VDGDNDGHINYDEFVAMMRKGNPEANPKKRRDVFV 535 >ref|XP_010247475.1| PREDICTED: calcium-dependent protein kinase 34 [Nelumbo nucifera] Length = 521 Score = 68.9 bits (167), Expect = 1e-09 Identities = 31/35 (88%), Positives = 32/35 (91%) Frame = -1 Query: 462 VGGDNDGRINYDEFVAMMRKGNPEANPKKRRDVVI 358 V DNDGRINYDEFVAMMRKGNPEANPKKRRDV + Sbjct: 487 VDSDNDGRINYDEFVAMMRKGNPEANPKKRRDVFV 521 >ref|XP_008449648.1| PREDICTED: calcium-dependent protein kinase 34-like [Cucumis melo] Length = 535 Score = 68.9 bits (167), Expect = 1e-09 Identities = 31/35 (88%), Positives = 32/35 (91%) Frame = -1 Query: 462 VGGDNDGRINYDEFVAMMRKGNPEANPKKRRDVVI 358 V DNDGRINYDEFVAMMRKGNPEANPKKRRDV + Sbjct: 501 VDADNDGRINYDEFVAMMRKGNPEANPKKRRDVFV 535 >ref|XP_012465908.1| PREDICTED: calcium-dependent protein kinase 17-like [Gossypium raimondii] gi|763816713|gb|KJB83565.1| hypothetical protein B456_013G253100 [Gossypium raimondii] Length = 527 Score = 67.8 bits (164), Expect = 3e-09 Identities = 30/35 (85%), Positives = 32/35 (91%) Frame = -1 Query: 462 VGGDNDGRINYDEFVAMMRKGNPEANPKKRRDVVI 358 V DNDGRINYDEFVAMM+KGNPE NPKKRRDVV+ Sbjct: 493 VDADNDGRINYDEFVAMMKKGNPEPNPKKRRDVVV 527 >emb|CBI24256.3| unnamed protein product [Vitis vinifera] Length = 497 Score = 67.8 bits (164), Expect = 3e-09 Identities = 30/35 (85%), Positives = 31/35 (88%) Frame = -1 Query: 462 VGGDNDGRINYDEFVAMMRKGNPEANPKKRRDVVI 358 V GDNDGRINYDEFV MMRKGNPE NPKKRRDV + Sbjct: 463 VDGDNDGRINYDEFVTMMRKGNPEPNPKKRRDVFV 497 >ref|XP_002276630.2| PREDICTED: calcium-dependent protein kinase 34-like [Vitis vinifera] Length = 534 Score = 67.8 bits (164), Expect = 3e-09 Identities = 30/35 (85%), Positives = 31/35 (88%) Frame = -1 Query: 462 VGGDNDGRINYDEFVAMMRKGNPEANPKKRRDVVI 358 V GDNDGRINYDEFV MMRKGNPE NPKKRRDV + Sbjct: 500 VDGDNDGRINYDEFVTMMRKGNPEPNPKKRRDVFV 534 >ref|XP_003568203.1| PREDICTED: calcium-dependent protein kinase 17-like [Brachypodium distachyon] gi|944070160|gb|KQK05644.1| hypothetical protein BRADI_2g21390 [Brachypodium distachyon] Length = 516 Score = 67.8 bits (164), Expect = 3e-09 Identities = 31/35 (88%), Positives = 32/35 (91%) Frame = -1 Query: 462 VGGDNDGRINYDEFVAMMRKGNPEANPKKRRDVVI 358 V GDNDGRINY EFVAMMRKG PEANPKKRRDVV+ Sbjct: 482 VDGDNDGRINYTEFVAMMRKGTPEANPKKRRDVVL 516 >emb|CAN62888.1| hypothetical protein VITISV_025544 [Vitis vinifera] Length = 540 Score = 67.8 bits (164), Expect = 3e-09 Identities = 30/35 (85%), Positives = 31/35 (88%) Frame = -1 Query: 462 VGGDNDGRINYDEFVAMMRKGNPEANPKKRRDVVI 358 V GDNDGRINYDEFV MMRKGNPE NPKKRRDV + Sbjct: 506 VDGDNDGRINYDEFVTMMRKGNPEPNPKKRRDVFV 540 >ref|XP_007015253.1| Calcium-dependent protein kinase 17 [Theobroma cacao] gi|508785616|gb|EOY32872.1| Calcium-dependent protein kinase 17 [Theobroma cacao] Length = 535 Score = 67.4 bits (163), Expect = 4e-09 Identities = 30/35 (85%), Positives = 31/35 (88%) Frame = -1 Query: 462 VGGDNDGRINYDEFVAMMRKGNPEANPKKRRDVVI 358 V DNDGRINYDEFVAMMRKGNPE NPKKRRDV + Sbjct: 501 VDSDNDGRINYDEFVAMMRKGNPETNPKKRRDVFV 535 >ref|XP_002299975.2| hypothetical protein POPTR_0001s28150g [Populus trichocarpa] gi|550348355|gb|EEE84780.2| hypothetical protein POPTR_0001s28150g [Populus trichocarpa] Length = 505 Score = 67.0 bits (162), Expect = 5e-09 Identities = 31/34 (91%), Positives = 31/34 (91%) Frame = -1 Query: 462 VGGDNDGRINYDEFVAMMRKGNPEANPKKRRDVV 361 V DNDGRINYDEFVAMMRKGNPEANPKKRRD V Sbjct: 470 VDADNDGRINYDEFVAMMRKGNPEANPKKRRDDV 503 >ref|XP_009419685.1| PREDICTED: calcium-dependent protein kinase 34-like [Musa acuminata subsp. malaccensis] Length = 524 Score = 66.6 bits (161), Expect = 7e-09 Identities = 30/32 (93%), Positives = 30/32 (93%) Frame = -1 Query: 453 DNDGRINYDEFVAMMRKGNPEANPKKRRDVVI 358 DNDGRINYDEF AMMRKGNPE NPKKRRDVVI Sbjct: 493 DNDGRINYDEFAAMMRKGNPEPNPKKRRDVVI 524 >ref|XP_006845045.1| PREDICTED: calcium-dependent protein kinase 17 [Amborella trichopoda] gi|548847542|gb|ERN06720.1| hypothetical protein AMTR_s00269p00011940 [Amborella trichopoda] Length = 517 Score = 66.6 bits (161), Expect = 7e-09 Identities = 30/32 (93%), Positives = 30/32 (93%) Frame = -1 Query: 462 VGGDNDGRINYDEFVAMMRKGNPEANPKKRRD 367 V DNDGRINYDEFVAMMRKGNPEANPKKRRD Sbjct: 483 VDADNDGRINYDEFVAMMRKGNPEANPKKRRD 514 >ref|XP_009404695.1| PREDICTED: calcium-dependent protein kinase 34-like [Musa acuminata subsp. malaccensis] Length = 515 Score = 66.2 bits (160), Expect = 9e-09 Identities = 30/32 (93%), Positives = 30/32 (93%) Frame = -1 Query: 453 DNDGRINYDEFVAMMRKGNPEANPKKRRDVVI 358 DNDGRINYDEFVAMMRKGNPE NPKKRRDV I Sbjct: 484 DNDGRINYDEFVAMMRKGNPEPNPKKRRDVFI 515 >ref|XP_002526062.1| calcium-dependent protein kinase, putative [Ricinus communis] gi|223534643|gb|EEF36339.1| calcium-dependent protein kinase, putative [Ricinus communis] Length = 536 Score = 66.2 bits (160), Expect = 9e-09 Identities = 30/34 (88%), Positives = 31/34 (91%) Frame = -1 Query: 462 VGGDNDGRINYDEFVAMMRKGNPEANPKKRRDVV 361 V D+DGRINYDEFVAMMRKGNPEANPKKRRD V Sbjct: 501 VDSDHDGRINYDEFVAMMRKGNPEANPKKRRDTV 534 >ref|XP_010106395.1| Calcium-dependent protein kinase 17 [Morus notabilis] gi|587923024|gb|EXC10389.1| Calcium-dependent protein kinase 17 [Morus notabilis] Length = 538 Score = 65.9 bits (159), Expect = 1e-08 Identities = 30/34 (88%), Positives = 31/34 (91%) Frame = -1 Query: 462 VGGDNDGRINYDEFVAMMRKGNPEANPKKRRDVV 361 V DNDGRINYDEFVAMMRKGNP+ANPKKRRD V Sbjct: 503 VDADNDGRINYDEFVAMMRKGNPDANPKKRRDDV 536 >ref|XP_009412989.1| PREDICTED: calcium-dependent protein kinase 17-like [Musa acuminata subsp. malaccensis] Length = 523 Score = 65.9 bits (159), Expect = 1e-08 Identities = 29/32 (90%), Positives = 30/32 (93%) Frame = -1 Query: 453 DNDGRINYDEFVAMMRKGNPEANPKKRRDVVI 358 DNDGRINYDEF AMMRKGNPE NPKKRRDVV+ Sbjct: 492 DNDGRINYDEFAAMMRKGNPEPNPKKRRDVVL 523 >ref|XP_008365176.1| PREDICTED: calcium-dependent protein kinase 17-like [Malus domestica] Length = 533 Score = 65.9 bits (159), Expect = 1e-08 Identities = 29/34 (85%), Positives = 31/34 (91%) Frame = -1 Query: 462 VGGDNDGRINYDEFVAMMRKGNPEANPKKRRDVV 361 + DNDGRINY+EFVAMMRKGNPEANPKKRRD V Sbjct: 498 IDADNDGRINYBEFVAMMRKGNPEANPKKRRDDV 531 >ref|XP_010031714.1| PREDICTED: calcium-dependent protein kinase 34-like [Eucalyptus grandis] gi|629084723|gb|KCW51080.1| hypothetical protein EUGRSUZ_J00686 [Eucalyptus grandis] Length = 534 Score = 65.9 bits (159), Expect = 1e-08 Identities = 29/35 (82%), Positives = 31/35 (88%) Frame = -1 Query: 462 VGGDNDGRINYDEFVAMMRKGNPEANPKKRRDVVI 358 V DNDGRINYDEFVAMMRKGNP+ NPKKRRDV + Sbjct: 500 VDADNDGRINYDEFVAMMRKGNPDPNPKKRRDVFV 534