BLASTX nr result
ID: Papaver30_contig00033488
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver30_contig00033488 (696 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012475359.1| PREDICTED: armadillo repeat-containing prote... 59 3e-06 ref|XP_010320081.1| PREDICTED: armadillo repeat-containing prote... 59 3e-06 ref|XP_009766936.1| PREDICTED: armadillo repeat-containing prote... 59 3e-06 ref|XP_009602049.1| PREDICTED: armadillo repeat-containing prote... 59 3e-06 ref|XP_006359821.1| PREDICTED: armadillo repeat-containing prote... 59 3e-06 ref|XP_004237786.1| PREDICTED: armadillo repeat-containing prote... 59 3e-06 ref|XP_004237785.1| PREDICTED: armadillo repeat-containing prote... 59 3e-06 ref|XP_011655146.1| PREDICTED: armadillo repeat-containing prote... 59 4e-06 ref|XP_011655143.1| PREDICTED: armadillo repeat-containing prote... 59 4e-06 gb|KGN50926.1| hypothetical protein Csa_5G346540 [Cucumis sativus] 59 4e-06 ref|XP_008463140.1| PREDICTED: armadillo repeat-containing prote... 59 4e-06 ref|XP_008463134.1| PREDICTED: armadillo repeat-containing prote... 59 4e-06 ref|XP_002523218.1| Armadillo repeat-containing protein, putativ... 59 4e-06 ref|XP_009771629.1| PREDICTED: armadillo repeat-containing prote... 57 9e-06 >ref|XP_012475359.1| PREDICTED: armadillo repeat-containing protein 7 isoform X3 [Gossypium raimondii] Length = 149 Score = 58.9 bits (141), Expect = 3e-06 Identities = 31/66 (46%), Positives = 39/66 (59%), Gaps = 13/66 (19%) Frame = -1 Query: 663 VWRWRFEQ-------------NGIPLVLECLSNAVGNTVNNALGAVYYLCNSVNK*EILS 523 +W WR Q GIPLV++CLS+ V NTVN ALGA+YYLCN N+ EIL Sbjct: 57 IWNWRHLQFLYPANAAIITQCGGIPLVIKCLSSPVRNTVNYALGALYYLCNKSNREEILK 116 Query: 522 LKSLGV 505 + + V Sbjct: 117 PEVIDV 122 >ref|XP_010320081.1| PREDICTED: armadillo repeat-containing protein 7 isoform X1 [Solanum lycopersicum] gi|723693815|ref|XP_010320082.1| PREDICTED: armadillo repeat-containing protein 7 isoform X1 [Solanum lycopersicum] gi|723693818|ref|XP_010320083.1| PREDICTED: armadillo repeat-containing protein 7 isoform X1 [Solanum lycopersicum] gi|723693821|ref|XP_010320084.1| PREDICTED: armadillo repeat-containing protein 7 isoform X1 [Solanum lycopersicum] gi|723693824|ref|XP_010320085.1| PREDICTED: armadillo repeat-containing protein 7 isoform X1 [Solanum lycopersicum] Length = 183 Score = 58.9 bits (141), Expect = 3e-06 Identities = 27/40 (67%), Positives = 34/40 (85%) Frame = -1 Query: 645 EQNGIPLVLECLSNAVGNTVNNALGAVYYLCNSVNK*EIL 526 + +GIPLV++CLS+ V NTVN ALGA+YYLCN+ NK EIL Sbjct: 107 QNDGIPLVIQCLSSPVRNTVNYALGALYYLCNASNKEEIL 146 >ref|XP_009766936.1| PREDICTED: armadillo repeat-containing protein 7 [Nicotiana sylvestris] gi|698544064|ref|XP_009766937.1| PREDICTED: armadillo repeat-containing protein 7 [Nicotiana sylvestris] gi|698544067|ref|XP_009766938.1| PREDICTED: armadillo repeat-containing protein 7 [Nicotiana sylvestris] gi|698544070|ref|XP_009766940.1| PREDICTED: armadillo repeat-containing protein 7 [Nicotiana sylvestris] gi|698544073|ref|XP_009766941.1| PREDICTED: armadillo repeat-containing protein 7 [Nicotiana sylvestris] Length = 174 Score = 58.9 bits (141), Expect = 3e-06 Identities = 27/40 (67%), Positives = 34/40 (85%) Frame = -1 Query: 645 EQNGIPLVLECLSNAVGNTVNNALGAVYYLCNSVNK*EIL 526 + +GIPLV++CLS+ V NTVN ALGA+YYLCN+ NK EIL Sbjct: 102 QNDGIPLVIQCLSSPVRNTVNYALGALYYLCNASNKEEIL 141 >ref|XP_009602049.1| PREDICTED: armadillo repeat-containing protein 7 [Nicotiana tomentosiformis] gi|697186034|ref|XP_009602050.1| PREDICTED: armadillo repeat-containing protein 7 [Nicotiana tomentosiformis] gi|697186036|ref|XP_009602051.1| PREDICTED: armadillo repeat-containing protein 7 [Nicotiana tomentosiformis] gi|697186038|ref|XP_009602052.1| PREDICTED: armadillo repeat-containing protein 7 [Nicotiana tomentosiformis] Length = 172 Score = 58.9 bits (141), Expect = 3e-06 Identities = 27/40 (67%), Positives = 34/40 (85%) Frame = -1 Query: 645 EQNGIPLVLECLSNAVGNTVNNALGAVYYLCNSVNK*EIL 526 + +GIPLV++CLS+ V NTVN ALGA+YYLCN+ NK EIL Sbjct: 102 QNDGIPLVIQCLSSPVRNTVNYALGALYYLCNASNKEEIL 141 >ref|XP_006359821.1| PREDICTED: armadillo repeat-containing protein 7-like [Solanum tuberosum] Length = 178 Score = 58.9 bits (141), Expect = 3e-06 Identities = 27/40 (67%), Positives = 34/40 (85%) Frame = -1 Query: 645 EQNGIPLVLECLSNAVGNTVNNALGAVYYLCNSVNK*EIL 526 + +GIPLV++CLS+ V NTVN ALGA+YYLCN+ NK EIL Sbjct: 102 QNDGIPLVIQCLSSPVRNTVNYALGALYYLCNASNKEEIL 141 >ref|XP_004237786.1| PREDICTED: armadillo repeat-containing protein 7 isoform X3 [Solanum lycopersicum] Length = 178 Score = 58.9 bits (141), Expect = 3e-06 Identities = 27/40 (67%), Positives = 34/40 (85%) Frame = -1 Query: 645 EQNGIPLVLECLSNAVGNTVNNALGAVYYLCNSVNK*EIL 526 + +GIPLV++CLS+ V NTVN ALGA+YYLCN+ NK EIL Sbjct: 102 QNDGIPLVIQCLSSPVRNTVNYALGALYYLCNASNKEEIL 141 >ref|XP_004237785.1| PREDICTED: armadillo repeat-containing protein 7 isoform X2 [Solanum lycopersicum] Length = 195 Score = 58.9 bits (141), Expect = 3e-06 Identities = 27/40 (67%), Positives = 34/40 (85%) Frame = -1 Query: 645 EQNGIPLVLECLSNAVGNTVNNALGAVYYLCNSVNK*EIL 526 + +GIPLV++CLS+ V NTVN ALGA+YYLCN+ NK EIL Sbjct: 119 QNDGIPLVIQCLSSPVRNTVNYALGALYYLCNASNKEEIL 158 >ref|XP_011655146.1| PREDICTED: armadillo repeat-containing protein 7 isoform X2 [Cucumis sativus] gi|778702162|ref|XP_011655147.1| PREDICTED: armadillo repeat-containing protein 7 isoform X2 [Cucumis sativus] Length = 166 Score = 58.5 bits (140), Expect = 4e-06 Identities = 26/37 (70%), Positives = 32/37 (86%) Frame = -1 Query: 636 GIPLVLECLSNAVGNTVNNALGAVYYLCNSVNK*EIL 526 GIPL++ECLS+ V NTVN ALGA+YYLCN+ NK EI+ Sbjct: 95 GIPLIIECLSSPVKNTVNYALGAIYYLCNASNKEEIM 131 >ref|XP_011655143.1| PREDICTED: armadillo repeat-containing protein 7 isoform X1 [Cucumis sativus] gi|778702153|ref|XP_011655144.1| PREDICTED: armadillo repeat-containing protein 7 isoform X1 [Cucumis sativus] gi|778702156|ref|XP_011655145.1| PREDICTED: armadillo repeat-containing protein 7 isoform X1 [Cucumis sativus] Length = 176 Score = 58.5 bits (140), Expect = 4e-06 Identities = 26/37 (70%), Positives = 32/37 (86%) Frame = -1 Query: 636 GIPLVLECLSNAVGNTVNNALGAVYYLCNSVNK*EIL 526 GIPL++ECLS+ V NTVN ALGA+YYLCN+ NK EI+ Sbjct: 105 GIPLIIECLSSPVKNTVNYALGAIYYLCNASNKEEIM 141 >gb|KGN50926.1| hypothetical protein Csa_5G346540 [Cucumis sativus] Length = 157 Score = 58.5 bits (140), Expect = 4e-06 Identities = 26/37 (70%), Positives = 32/37 (86%) Frame = -1 Query: 636 GIPLVLECLSNAVGNTVNNALGAVYYLCNSVNK*EIL 526 GIPL++ECLS+ V NTVN ALGA+YYLCN+ NK EI+ Sbjct: 86 GIPLIIECLSSPVKNTVNYALGAIYYLCNASNKEEIM 122 >ref|XP_008463140.1| PREDICTED: armadillo repeat-containing protein 7 isoform X2 [Cucumis melo] gi|659126358|ref|XP_008463141.1| PREDICTED: armadillo repeat-containing protein 7 isoform X2 [Cucumis melo] gi|659126360|ref|XP_008463142.1| PREDICTED: armadillo repeat-containing protein 7 isoform X2 [Cucumis melo] Length = 166 Score = 58.5 bits (140), Expect = 4e-06 Identities = 26/37 (70%), Positives = 32/37 (86%) Frame = -1 Query: 636 GIPLVLECLSNAVGNTVNNALGAVYYLCNSVNK*EIL 526 GIPL++ECLS+ V NTVN ALGA+YYLCN+ NK EI+ Sbjct: 95 GIPLIIECLSSPVKNTVNYALGAIYYLCNASNKEEIM 131 >ref|XP_008463134.1| PREDICTED: armadillo repeat-containing protein 7 isoform X1 [Cucumis melo] gi|659126346|ref|XP_008463135.1| PREDICTED: armadillo repeat-containing protein 7 isoform X1 [Cucumis melo] gi|659126348|ref|XP_008463136.1| PREDICTED: armadillo repeat-containing protein 7 isoform X1 [Cucumis melo] gi|659126350|ref|XP_008463137.1| PREDICTED: armadillo repeat-containing protein 7 isoform X1 [Cucumis melo] gi|659126352|ref|XP_008463138.1| PREDICTED: armadillo repeat-containing protein 7 isoform X1 [Cucumis melo] gi|659126354|ref|XP_008463139.1| PREDICTED: armadillo repeat-containing protein 7 isoform X1 [Cucumis melo] Length = 176 Score = 58.5 bits (140), Expect = 4e-06 Identities = 26/37 (70%), Positives = 32/37 (86%) Frame = -1 Query: 636 GIPLVLECLSNAVGNTVNNALGAVYYLCNSVNK*EIL 526 GIPL++ECLS+ V NTVN ALGA+YYLCN+ NK EI+ Sbjct: 105 GIPLIIECLSSPVKNTVNYALGAIYYLCNASNKEEIM 141 >ref|XP_002523218.1| Armadillo repeat-containing protein, putative [Ricinus communis] gi|223537514|gb|EEF39139.1| Armadillo repeat-containing protein, putative [Ricinus communis] Length = 172 Score = 58.5 bits (140), Expect = 4e-06 Identities = 26/40 (65%), Positives = 33/40 (82%) Frame = -1 Query: 645 EQNGIPLVLECLSNAVGNTVNNALGAVYYLCNSVNK*EIL 526 + GIPL+++CLS+ V NTVN A+GA+YYLCNS NK EIL Sbjct: 102 QSGGIPLIIQCLSSPVRNTVNYAIGALYYLCNSSNKEEIL 141 >ref|XP_009771629.1| PREDICTED: armadillo repeat-containing protein 7-like, partial [Nicotiana sylvestris] Length = 145 Score = 57.4 bits (137), Expect = 9e-06 Identities = 26/40 (65%), Positives = 33/40 (82%) Frame = -1 Query: 645 EQNGIPLVLECLSNAVGNTVNNALGAVYYLCNSVNK*EIL 526 + +GIPLV++CLS+ NTVN ALGA+YYLCN+ NK EIL Sbjct: 73 QNDGIPLVIQCLSSPARNTVNYALGALYYLCNASNKEEIL 112