BLASTX nr result
ID: Papaver30_contig00033373
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver30_contig00033373 (1688 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ERN14163.1| hypothetical protein AMTR_s00033p00009800 [Ambore... 60 6e-06 >gb|ERN14163.1| hypothetical protein AMTR_s00033p00009800 [Amborella trichopoda] Length = 457 Score = 60.1 bits (144), Expect = 6e-06 Identities = 42/103 (40%), Positives = 52/103 (50%), Gaps = 7/103 (6%) Frame = -1 Query: 401 TWLYVNDQFLIWDPEHQIMTG*YHSEYTIPCSCTIRK*SFPALILSGDSFCTNLIRFRIL 222 TW++VNDQFL WDPEHQI + ++ AL + + C L Sbjct: 23 TWVFVNDQFLNWDPEHQIKVR------------IVSARAYHALFMH--NMCIRPTAEE-L 67 Query: 221 HNL*CWTVPIYN-------HYTYYMTSSTIIDLNLARRDMVIL 114 N IYN YT+YMTSST IDLNLAR++MVIL Sbjct: 68 ENFGTPDFTIYNAGQFPCNRYTHYMTSSTSIDLNLARKEMVIL 110