BLASTX nr result
ID: Papaver30_contig00033205
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver30_contig00033205 (1399 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012846099.1| PREDICTED: 50S ribosomal protein L15, chloro... 60 5e-06 gb|ABK25784.1| unknown [Picea sitchensis] 60 5e-06 gb|EYU29983.1| hypothetical protein MIMGU_mgv1a011607mg [Erythra... 60 6e-06 ref|XP_011070796.1| PREDICTED: 50S ribosomal protein L15, chloro... 59 8e-06 ref|XP_009803210.1| PREDICTED: 50S ribosomal protein L15, chloro... 59 8e-06 ref|XP_009608091.1| PREDICTED: 50S ribosomal protein L15, chloro... 59 8e-06 gb|KFK33537.1| hypothetical protein AALP_AA5G026400 [Arabis alpina] 59 8e-06 gb|KFK33536.1| hypothetical protein AALP_AA5G026200 [Arabis alpina] 59 8e-06 ref|XP_006344133.1| PREDICTED: 50S ribosomal protein L15, chloro... 59 8e-06 ref|XP_004238931.1| PREDICTED: 50S ribosomal protein L15, chloro... 59 8e-06 >ref|XP_012846099.1| PREDICTED: 50S ribosomal protein L15, chloroplastic [Erythranthe guttatus] gi|604318490|gb|EYU29982.1| hypothetical protein MIMGU_mgv1a011607mg [Erythranthe guttata] Length = 276 Score = 60.1 bits (144), Expect = 5e-06 Identities = 31/35 (88%), Positives = 33/35 (94%) Frame = -2 Query: 381 ESGFAEDGEEVSLESLKSKGLINPSGRERRLPLKI 277 E+GF E+GEEVSLESLK KGLINPSGRERRLPLKI Sbjct: 164 EAGF-EEGEEVSLESLKMKGLINPSGRERRLPLKI 197 >gb|ABK25784.1| unknown [Picea sitchensis] Length = 263 Score = 60.1 bits (144), Expect = 5e-06 Identities = 31/34 (91%), Positives = 33/34 (97%) Frame = -2 Query: 378 SGFAEDGEEVSLESLKSKGLINPSGRERRLPLKI 277 +GF +DGEEVSLESLKSKGLINPSGRERRLPLKI Sbjct: 165 AGF-KDGEEVSLESLKSKGLINPSGRERRLPLKI 197 >gb|EYU29983.1| hypothetical protein MIMGU_mgv1a011607mg [Erythranthe guttata] Length = 200 Score = 59.7 bits (143), Expect = 6e-06 Identities = 30/35 (85%), Positives = 33/35 (94%) Frame = -2 Query: 381 ESGFAEDGEEVSLESLKSKGLINPSGRERRLPLKI 277 E+GF E+GEEVSLESLK KGLINPSGRERRLPLK+ Sbjct: 164 EAGF-EEGEEVSLESLKMKGLINPSGRERRLPLKV 197 >ref|XP_011070796.1| PREDICTED: 50S ribosomal protein L15, chloroplastic [Sesamum indicum] Length = 270 Score = 59.3 bits (142), Expect = 8e-06 Identities = 30/35 (85%), Positives = 33/35 (94%) Frame = -2 Query: 381 ESGFAEDGEEVSLESLKSKGLINPSGRERRLPLKI 277 ++GF E+GEEVSLESLK KGLINPSGRERRLPLKI Sbjct: 165 DAGF-EEGEEVSLESLKKKGLINPSGRERRLPLKI 198 >ref|XP_009803210.1| PREDICTED: 50S ribosomal protein L15, chloroplastic [Nicotiana sylvestris] Length = 267 Score = 59.3 bits (142), Expect = 8e-06 Identities = 31/35 (88%), Positives = 32/35 (91%) Frame = -2 Query: 381 ESGFAEDGEEVSLESLKSKGLINPSGRERRLPLKI 277 E+GF E GEEVSLESLK KGLINPSGRERRLPLKI Sbjct: 160 EAGFQE-GEEVSLESLKQKGLINPSGRERRLPLKI 193 >ref|XP_009608091.1| PREDICTED: 50S ribosomal protein L15, chloroplastic [Nicotiana tomentosiformis] Length = 267 Score = 59.3 bits (142), Expect = 8e-06 Identities = 31/35 (88%), Positives = 32/35 (91%) Frame = -2 Query: 381 ESGFAEDGEEVSLESLKSKGLINPSGRERRLPLKI 277 E+GF E GEEVSLESLK KGLINPSGRERRLPLKI Sbjct: 160 EAGFQE-GEEVSLESLKQKGLINPSGRERRLPLKI 193 >gb|KFK33537.1| hypothetical protein AALP_AA5G026400 [Arabis alpina] Length = 197 Score = 59.3 bits (142), Expect = 8e-06 Identities = 30/34 (88%), Positives = 33/34 (97%) Frame = -2 Query: 378 SGFAEDGEEVSLESLKSKGLINPSGRERRLPLKI 277 +GF EDG+EVSLE+LKSKGLINPSGRERRLPLKI Sbjct: 87 AGF-EDGDEVSLETLKSKGLINPSGRERRLPLKI 119 >gb|KFK33536.1| hypothetical protein AALP_AA5G026200 [Arabis alpina] Length = 443 Score = 59.3 bits (142), Expect = 8e-06 Identities = 30/34 (88%), Positives = 33/34 (97%) Frame = -2 Query: 378 SGFAEDGEEVSLESLKSKGLINPSGRERRLPLKI 277 +GF EDG+EVSLE+LKSKGLINPSGRERRLPLKI Sbjct: 334 AGF-EDGDEVSLETLKSKGLINPSGRERRLPLKI 366 >ref|XP_006344133.1| PREDICTED: 50S ribosomal protein L15, chloroplastic-like [Solanum tuberosum] Length = 276 Score = 59.3 bits (142), Expect = 8e-06 Identities = 31/35 (88%), Positives = 32/35 (91%) Frame = -2 Query: 381 ESGFAEDGEEVSLESLKSKGLINPSGRERRLPLKI 277 E+GF E GEEVSLESLK KGLINPSGRERRLPLKI Sbjct: 168 EAGFQE-GEEVSLESLKQKGLINPSGRERRLPLKI 201 >ref|XP_004238931.1| PREDICTED: 50S ribosomal protein L15, chloroplastic [Solanum lycopersicum] Length = 271 Score = 59.3 bits (142), Expect = 8e-06 Identities = 31/35 (88%), Positives = 32/35 (91%) Frame = -2 Query: 381 ESGFAEDGEEVSLESLKSKGLINPSGRERRLPLKI 277 E+GF E GEEVSLESLK KGLINPSGRERRLPLKI Sbjct: 165 EAGFQE-GEEVSLESLKQKGLINPSGRERRLPLKI 198