BLASTX nr result
ID: Papaver30_contig00032744
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver30_contig00032744 (1176 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009597988.1| PREDICTED: L-gulonolactone oxidase [Nicotian... 60 4e-06 >ref|XP_009597988.1| PREDICTED: L-gulonolactone oxidase [Nicotiana tomentosiformis] Length = 583 Score = 60.1 bits (144), Expect = 4e-06 Identities = 35/67 (52%), Positives = 44/67 (65%) Frame = +1 Query: 463 APKLIYPKTNEELLQLFIDQANRKKLNKVKIIPRFSHIVPKLAMNKIINNFFPLSTAKYN 642 APK++YP T EEL Q + AN+ KL KVK++ RFSH +PKLA N +ST KY+ Sbjct: 56 APKIVYPTTEEELRQELAN-ANKNKL-KVKVVTRFSHTIPKLACPSTGNAAVFISTEKYD 113 Query: 643 S*IKVDV 663 S I VDV Sbjct: 114 SNINVDV 120