BLASTX nr result
ID: Papaver30_contig00031250
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver30_contig00031250 (441 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_013458378.1| FYVE zinc finger protein [Medicago truncatul... 70 8e-10 ref|XP_013458377.1| FYVE zinc finger protein [Medicago truncatul... 70 8e-10 ref|XP_003609917.1| FYVE zinc finger protein [Medicago truncatul... 70 8e-10 gb|AFK44572.1| unknown [Medicago truncatula] 69 1e-09 ref|XP_011002822.1| PREDICTED: hepatocyte growth factor-regulate... 69 1e-09 gb|KHN45033.1| Vacuolar protein sorting-associated protein 27 [G... 69 1e-09 ref|XP_002324207.1| ankyrin repeat family protein [Populus trich... 69 1e-09 ref|NP_001241998.1| uncharacterized protein LOC100814367 [Glycin... 69 1e-09 ref|XP_003551016.1| PREDICTED: hepatocyte growth factor-regulate... 69 2e-09 gb|AFK44655.1| unknown [Lotus japonicus] 68 2e-09 ref|XP_014505615.1| PREDICTED: vacuolar protein sorting-associat... 68 3e-09 ref|XP_010653064.1| PREDICTED: uncharacterized protein LOC100242... 68 3e-09 ref|XP_010047417.1| PREDICTED: hepatocyte growth factor-regulate... 68 3e-09 ref|XP_002268154.1| PREDICTED: FYVE and coiled-coil domain-conta... 68 3e-09 ref|XP_003616559.2| hypothetical protein MTR_5g081760 [Medicago ... 67 4e-09 ref|XP_002309448.1| ankyrin repeat family protein [Populus trich... 67 4e-09 ref|XP_006381990.1| hypothetical protein POPTR_0006s23370g [Popu... 67 4e-09 ref|XP_004508058.1| PREDICTED: hepatocyte growth factor-regulate... 67 4e-09 ref|XP_004508057.1| PREDICTED: vacuolar protein sorting-associat... 67 4e-09 ref|XP_011019290.1| PREDICTED: hepatocyte growth factor-regulate... 67 5e-09 >ref|XP_013458378.1| FYVE zinc finger protein [Medicago truncatula] gi|657391058|gb|KEH32409.1| FYVE zinc finger protein [Medicago truncatula] Length = 291 Score = 69.7 bits (169), Expect = 8e-10 Identities = 34/43 (79%), Positives = 37/43 (86%), Gaps = 1/43 (2%) Frame = -1 Query: 441 IAFILMDNGANLEYKNQQGETALDCAPTTLQYRMKQKM-ENGA 316 I FILMD+GANLEYKN QGET LDCAP TLQY+MK KM E+GA Sbjct: 244 IVFILMDSGANLEYKNAQGETPLDCAPATLQYKMKMKMQESGA 286 >ref|XP_013458377.1| FYVE zinc finger protein [Medicago truncatula] gi|657391057|gb|KEH32408.1| FYVE zinc finger protein [Medicago truncatula] Length = 240 Score = 69.7 bits (169), Expect = 8e-10 Identities = 34/43 (79%), Positives = 37/43 (86%), Gaps = 1/43 (2%) Frame = -1 Query: 441 IAFILMDNGANLEYKNQQGETALDCAPTTLQYRMKQKM-ENGA 316 I FILMD+GANLEYKN QGET LDCAP TLQY+MK KM E+GA Sbjct: 193 IVFILMDSGANLEYKNAQGETPLDCAPATLQYKMKMKMQESGA 235 >ref|XP_003609917.1| FYVE zinc finger protein [Medicago truncatula] gi|355510972|gb|AES92114.1| FYVE zinc finger protein [Medicago truncatula] Length = 292 Score = 69.7 bits (169), Expect = 8e-10 Identities = 34/43 (79%), Positives = 37/43 (86%), Gaps = 1/43 (2%) Frame = -1 Query: 441 IAFILMDNGANLEYKNQQGETALDCAPTTLQYRMKQKM-ENGA 316 I FILMD+GANLEYKN QGET LDCAP TLQY+MK KM E+GA Sbjct: 245 IVFILMDSGANLEYKNAQGETPLDCAPATLQYKMKMKMQESGA 287 >gb|AFK44572.1| unknown [Medicago truncatula] Length = 292 Score = 69.3 bits (168), Expect = 1e-09 Identities = 34/43 (79%), Positives = 36/43 (83%), Gaps = 1/43 (2%) Frame = -1 Query: 441 IAFILMDNGANLEYKNQQGETALDCAPTTLQYRMKQKM-ENGA 316 I FILMD+GANLEYKN QGET LDCAP TLQY+MK KM E GA Sbjct: 245 IVFILMDSGANLEYKNAQGETPLDCAPATLQYKMKMKMQERGA 287 >ref|XP_011002822.1| PREDICTED: hepatocyte growth factor-regulated tyrosine kinase substrate-like [Populus euphratica] Length = 287 Score = 68.9 bits (167), Expect = 1e-09 Identities = 31/39 (79%), Positives = 35/39 (89%) Frame = -1 Query: 441 IAFILMDNGANLEYKNQQGETALDCAPTTLQYRMKQKME 325 IAFILMD+GA++ YKN QGET LDCAP TLQY+MKQKME Sbjct: 238 IAFILMDSGASMNYKNAQGETPLDCAPATLQYKMKQKME 276 >gb|KHN45033.1| Vacuolar protein sorting-associated protein 27 [Glycine soja] gi|947070528|gb|KRH19419.1| hypothetical protein GLYMA_13G116000 [Glycine max] Length = 291 Score = 68.9 bits (167), Expect = 1e-09 Identities = 30/41 (73%), Positives = 36/41 (87%) Frame = -1 Query: 441 IAFILMDNGANLEYKNQQGETALDCAPTTLQYRMKQKMENG 319 I FILMD+GA+LEYKN QGET +DCAP TLQY+M++KME G Sbjct: 244 IVFILMDSGASLEYKNAQGETPIDCAPATLQYKMRKKMEEG 284 >ref|XP_002324207.1| ankyrin repeat family protein [Populus trichocarpa] gi|222865641|gb|EEF02772.1| ankyrin repeat family protein [Populus trichocarpa] Length = 288 Score = 68.9 bits (167), Expect = 1e-09 Identities = 31/39 (79%), Positives = 35/39 (89%) Frame = -1 Query: 441 IAFILMDNGANLEYKNQQGETALDCAPTTLQYRMKQKME 325 IAFILMD+GA++ YKN QGET LDCAP TLQY+MKQKME Sbjct: 239 IAFILMDSGASMNYKNAQGETPLDCAPATLQYKMKQKME 277 >ref|NP_001241998.1| uncharacterized protein LOC100814367 [Glycine max] gi|255636154|gb|ACU18419.1| unknown [Glycine max] Length = 291 Score = 68.9 bits (167), Expect = 1e-09 Identities = 30/41 (73%), Positives = 36/41 (87%) Frame = -1 Query: 441 IAFILMDNGANLEYKNQQGETALDCAPTTLQYRMKQKMENG 319 I FILMD+GA+LEYKN QGET +DCAP TLQY+M++KME G Sbjct: 244 IVFILMDSGASLEYKNAQGETPIDCAPATLQYKMRKKMEEG 284 >ref|XP_003551016.1| PREDICTED: hepatocyte growth factor-regulated tyrosine kinase substrate-like [Glycine max] gi|734365396|gb|KHN17775.1| Vacuolar protein sorting-associated protein 27 [Glycine soja] gi|947053071|gb|KRH02524.1| hypothetical protein GLYMA_17G043800 [Glycine max] Length = 291 Score = 68.6 bits (166), Expect = 2e-09 Identities = 30/41 (73%), Positives = 36/41 (87%) Frame = -1 Query: 441 IAFILMDNGANLEYKNQQGETALDCAPTTLQYRMKQKMENG 319 I FILMD+GA+LEY+N QGET LDCAP TLQY+M++KME G Sbjct: 244 IVFILMDSGASLEYRNAQGETPLDCAPATLQYKMRKKMEEG 284 >gb|AFK44655.1| unknown [Lotus japonicus] Length = 289 Score = 68.2 bits (165), Expect = 2e-09 Identities = 30/41 (73%), Positives = 36/41 (87%) Frame = -1 Query: 441 IAFILMDNGANLEYKNQQGETALDCAPTTLQYRMKQKMENG 319 I FILMD+GA+L+YKN QGET LDCAP TLQY+M++KME G Sbjct: 242 IVFILMDSGASLKYKNAQGETPLDCAPATLQYKMRKKMEEG 282 >ref|XP_014505615.1| PREDICTED: vacuolar protein sorting-associated protein 27 [Vigna radiata var. radiata] Length = 279 Score = 67.8 bits (164), Expect = 3e-09 Identities = 30/41 (73%), Positives = 35/41 (85%) Frame = -1 Query: 441 IAFILMDNGANLEYKNQQGETALDCAPTTLQYRMKQKMENG 319 I F LMD+GA+LEYKN QGET LDCAP TLQY+M++KME G Sbjct: 235 IVFTLMDSGASLEYKNAQGETPLDCAPATLQYKMRKKMEEG 275 >ref|XP_010653064.1| PREDICTED: uncharacterized protein LOC100242638 isoform X2 [Vitis vinifera] Length = 244 Score = 67.8 bits (164), Expect = 3e-09 Identities = 30/41 (73%), Positives = 37/41 (90%) Frame = -1 Query: 441 IAFILMDNGANLEYKNQQGETALDCAPTTLQYRMKQKMENG 319 IAFILM++GA+LE+KN QGET LDCAP TLQY+M++KME G Sbjct: 200 IAFILMESGASLEHKNAQGETPLDCAPATLQYKMRKKMEEG 240 >ref|XP_010047417.1| PREDICTED: hepatocyte growth factor-regulated tyrosine kinase substrate [Eucalyptus grandis] gi|629114660|gb|KCW79335.1| hypothetical protein EUGRSUZ_C00754 [Eucalyptus grandis] Length = 280 Score = 67.8 bits (164), Expect = 3e-09 Identities = 29/41 (70%), Positives = 37/41 (90%) Frame = -1 Query: 441 IAFILMDNGANLEYKNQQGETALDCAPTTLQYRMKQKMENG 319 IAFILM++GA+++Y+N QGET LDCAP TLQY+M+QKME G Sbjct: 239 IAFILMEHGASVDYRNAQGETPLDCAPATLQYKMRQKMEEG 279 >ref|XP_002268154.1| PREDICTED: FYVE and coiled-coil domain-containing protein 1 isoform X1 [Vitis vinifera] gi|296084844|emb|CBI27726.3| unnamed protein product [Vitis vinifera] Length = 289 Score = 67.8 bits (164), Expect = 3e-09 Identities = 30/41 (73%), Positives = 37/41 (90%) Frame = -1 Query: 441 IAFILMDNGANLEYKNQQGETALDCAPTTLQYRMKQKMENG 319 IAFILM++GA+LE+KN QGET LDCAP TLQY+M++KME G Sbjct: 245 IAFILMESGASLEHKNAQGETPLDCAPATLQYKMRKKMEEG 285 >ref|XP_003616559.2| hypothetical protein MTR_5g081760 [Medicago truncatula] gi|657385581|gb|AES99517.2| hypothetical protein MTR_5g081760 [Medicago truncatula] Length = 125 Score = 67.4 bits (163), Expect = 4e-09 Identities = 33/43 (76%), Positives = 36/43 (83%), Gaps = 1/43 (2%) Frame = -1 Query: 441 IAFILMDNGANLEYKNQQGETALDCAPTTLQYRMKQKM-ENGA 316 I FILMD+G NLEYKN QGET LDCAP TLQY+MK KM E+GA Sbjct: 78 IVFILMDSGENLEYKNGQGETPLDCAPATLQYKMKMKMQESGA 120 >ref|XP_002309448.1| ankyrin repeat family protein [Populus trichocarpa] gi|222855424|gb|EEE92971.1| ankyrin repeat family protein [Populus trichocarpa] Length = 255 Score = 67.4 bits (163), Expect = 4e-09 Identities = 30/39 (76%), Positives = 35/39 (89%) Frame = -1 Query: 441 IAFILMDNGANLEYKNQQGETALDCAPTTLQYRMKQKME 325 IAFILMD+GA++ YKN QGET LDCAP TLQY+MKQK+E Sbjct: 206 IAFILMDSGASMNYKNAQGETPLDCAPATLQYKMKQKVE 244 >ref|XP_006381990.1| hypothetical protein POPTR_0006s23370g [Populus trichocarpa] gi|550336928|gb|ERP59787.1| hypothetical protein POPTR_0006s23370g [Populus trichocarpa] Length = 294 Score = 67.4 bits (163), Expect = 4e-09 Identities = 30/39 (76%), Positives = 35/39 (89%) Frame = -1 Query: 441 IAFILMDNGANLEYKNQQGETALDCAPTTLQYRMKQKME 325 IAFILMD+GA++ YKN QGET LDCAP TLQY+MKQK+E Sbjct: 245 IAFILMDSGASMNYKNAQGETPLDCAPATLQYKMKQKVE 283 >ref|XP_004508058.1| PREDICTED: hepatocyte growth factor-regulated tyrosine kinase substrate isoform X2 [Cicer arietinum] Length = 288 Score = 67.4 bits (163), Expect = 4e-09 Identities = 30/39 (76%), Positives = 35/39 (89%) Frame = -1 Query: 441 IAFILMDNGANLEYKNQQGETALDCAPTTLQYRMKQKME 325 I FILMD+GA+LEYKN QGET LDCAP TLQY+M++KME Sbjct: 244 IVFILMDSGASLEYKNAQGETPLDCAPATLQYKMRKKME 282 >ref|XP_004508057.1| PREDICTED: vacuolar protein sorting-associated protein 27 isoform X1 [Cicer arietinum] Length = 289 Score = 67.4 bits (163), Expect = 4e-09 Identities = 30/39 (76%), Positives = 35/39 (89%) Frame = -1 Query: 441 IAFILMDNGANLEYKNQQGETALDCAPTTLQYRMKQKME 325 I FILMD+GA+LEYKN QGET LDCAP TLQY+M++KME Sbjct: 245 IVFILMDSGASLEYKNAQGETPLDCAPATLQYKMRKKME 283 >ref|XP_011019290.1| PREDICTED: hepatocyte growth factor-regulated tyrosine kinase substrate [Populus euphratica] Length = 294 Score = 67.0 bits (162), Expect = 5e-09 Identities = 30/39 (76%), Positives = 35/39 (89%) Frame = -1 Query: 441 IAFILMDNGANLEYKNQQGETALDCAPTTLQYRMKQKME 325 IAFILMD+GA++ YKN QGET LDCAP TLQY+MKQK+E Sbjct: 245 IAFILMDSGASMNYKNGQGETPLDCAPATLQYKMKQKVE 283