BLASTX nr result
ID: Papaver30_contig00031209
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver30_contig00031209 (903 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_008362039.1| PREDICTED: cellulose synthase-like protein E... 67 2e-11 ref|XP_012841593.1| PREDICTED: uncharacterized protein LOC105961... 64 3e-11 gb|EYU33711.1| hypothetical protein MIMGU_mgv1a001960mg [Erythra... 64 3e-11 ref|XP_009624029.1| PREDICTED: cellulose synthase-like protein E... 65 4e-11 gb|AAZ32787.1| cellulose synthase-like protein CslE [Nicotiana t... 65 4e-11 ref|XP_009418093.1| PREDICTED: cellulose synthase-like protein E... 66 6e-11 ref|XP_010088429.1| Cellulose synthase-like protein E1 [Morus no... 64 6e-11 ref|XP_009349137.1| PREDICTED: cellulose synthase-like protein E... 65 6e-11 ref|XP_007142429.1| hypothetical protein PHAVU_008G279700g [Phas... 65 1e-10 ref|XP_002274290.2| PREDICTED: cellulose synthase-like protein E... 64 1e-10 ref|XP_003635361.2| PREDICTED: cellulose synthase-like protein E... 64 1e-10 ref|XP_007142428.1| hypothetical protein PHAVU_008G279700g [Phas... 65 1e-10 ref|XP_007142427.1| hypothetical protein PHAVU_008G279700g [Phas... 65 1e-10 ref|XP_003635328.1| PREDICTED: cellulose synthase-like protein E... 64 1e-10 ref|XP_008366098.1| PREDICTED: cellulose synthase-like protein E... 64 1e-10 ref|XP_008366099.1| PREDICTED: cellulose synthase-like protein E... 64 1e-10 emb|CBI23494.3| unnamed protein product [Vitis vinifera] 64 1e-10 emb|CBI29435.3| unnamed protein product [Vitis vinifera] 64 1e-10 emb|CBI23490.3| unnamed protein product [Vitis vinifera] 64 1e-10 ref|XP_008349391.1| PREDICTED: cellulose synthase-like protein E... 64 1e-10 >ref|XP_008362039.1| PREDICTED: cellulose synthase-like protein E2 [Malus domestica] Length = 204 Score = 67.0 bits (162), Expect(2) = 2e-11 Identities = 30/50 (60%), Positives = 38/50 (76%) Frame = +1 Query: 754 TLFLVMAFKYPAENFSLYLSDDGG*EMTFYALLEAFRLAKFWITFGKQYK 903 T+ VMA+ YP E S+YLSDDGG E+T+YALLEA AK+WI + K+YK Sbjct: 119 TVLSVMAYDYPPEKLSVYLSDDGGSELTYYALLEAAEFAKYWIPYCKRYK 168 Score = 30.0 bits (66), Expect(2) = 2e-11 Identities = 17/35 (48%), Positives = 18/35 (51%) Frame = +3 Query: 663 RYEENLPGVXXXXXXXXXVRRIIEPPIMVINTFFS 767 RYE LPGV IEPP+MVINT S Sbjct: 91 RYENELPGVDVFVCTADPT---IEPPMMVINTVLS 122 >ref|XP_012841593.1| PREDICTED: uncharacterized protein LOC105961875 [Erythranthe guttatus] Length = 1478 Score = 63.9 bits (154), Expect(2) = 3e-11 Identities = 29/49 (59%), Positives = 37/49 (75%) Frame = +1 Query: 754 TLFLVMAFKYPAENFSLYLSDDGG*EMTFYALLEAFRLAKFWITFGKQY 900 T+ VMA+ YP E ++YLSDDGG E+TFYALLEA R AK WI + K++ Sbjct: 861 TVLSVMAYSYPPEKLAVYLSDDGGSEITFYALLEASRFAKHWIPYCKKF 909 Score = 32.7 bits (73), Expect(2) = 3e-11 Identities = 18/35 (51%), Positives = 21/35 (60%) Frame = +3 Query: 663 RYEENLPGVXXXXXXXXXVRRIIEPPIMVINTFFS 767 RYE++LPGV V IEPP+MVINT S Sbjct: 833 RYEDDLPGVDVFVCTADPV---IEPPMMVINTVLS 864 >gb|EYU33711.1| hypothetical protein MIMGU_mgv1a001960mg [Erythranthe guttata] Length = 733 Score = 63.9 bits (154), Expect(2) = 3e-11 Identities = 29/49 (59%), Positives = 37/49 (75%) Frame = +1 Query: 754 TLFLVMAFKYPAENFSLYLSDDGG*EMTFYALLEAFRLAKFWITFGKQY 900 T+ VMA+ YP E ++YLSDDGG E+TFYALLEA R AK WI + K++ Sbjct: 116 TVLSVMAYSYPPEKLAVYLSDDGGSEITFYALLEASRFAKHWIPYCKKF 164 Score = 32.7 bits (73), Expect(2) = 3e-11 Identities = 18/35 (51%), Positives = 21/35 (60%) Frame = +3 Query: 663 RYEENLPGVXXXXXXXXXVRRIIEPPIMVINTFFS 767 RYE++LPGV V IEPP+MVINT S Sbjct: 88 RYEDDLPGVDVFVCTADPV---IEPPMMVINTVLS 119 >ref|XP_009624029.1| PREDICTED: cellulose synthase-like protein E6 [Nicotiana tomentosiformis] Length = 740 Score = 65.1 bits (157), Expect(2) = 4e-11 Identities = 29/49 (59%), Positives = 37/49 (75%) Frame = +1 Query: 754 TLFLVMAFKYPAENFSLYLSDDGG*EMTFYALLEAFRLAKFWITFGKQY 900 T+ VM++ YP E S+YLSDDGG E TFYALLEA R +K+WI F K++ Sbjct: 130 TILSVMSYNYPPEKLSVYLSDDGGSEYTFYALLEASRFSKYWIPFCKKF 178 Score = 30.8 bits (68), Expect(2) = 4e-11 Identities = 17/35 (48%), Positives = 19/35 (54%) Frame = +3 Query: 663 RYEENLPGVXXXXXXXXXVRRIIEPPIMVINTFFS 767 RYEE LPGV I+EPP +VINT S Sbjct: 102 RYEEKLPGVDIFVCTADP---IMEPPTLVINTILS 133 >gb|AAZ32787.1| cellulose synthase-like protein CslE [Nicotiana tabacum] Length = 740 Score = 65.1 bits (157), Expect(2) = 4e-11 Identities = 29/49 (59%), Positives = 37/49 (75%) Frame = +1 Query: 754 TLFLVMAFKYPAENFSLYLSDDGG*EMTFYALLEAFRLAKFWITFGKQY 900 T+ VM++ YP E S+YLSDDGG E TFYALLEA R +K+WI F K++ Sbjct: 130 TILSVMSYNYPPEKLSVYLSDDGGSEYTFYALLEASRFSKYWIPFCKKF 178 Score = 30.8 bits (68), Expect(2) = 4e-11 Identities = 17/35 (48%), Positives = 19/35 (54%) Frame = +3 Query: 663 RYEENLPGVXXXXXXXXXVRRIIEPPIMVINTFFS 767 RYEE LPGV I+EPP +VINT S Sbjct: 102 RYEEKLPGVDIFVCTADP---IMEPPTLVINTILS 133 >ref|XP_009418093.1| PREDICTED: cellulose synthase-like protein E6 [Musa acuminata subsp. malaccensis] Length = 746 Score = 65.9 bits (159), Expect(2) = 6e-11 Identities = 30/50 (60%), Positives = 38/50 (76%) Frame = +1 Query: 754 TLFLVMAFKYPAENFSLYLSDDGG*EMTFYALLEAFRLAKFWITFGKQYK 903 T+ VMA++YP E S+YLSDD G E+TFYALLEA R AK W+ F K++K Sbjct: 124 TVLSVMAYQYPVEKLSVYLSDDSGSELTFYALLEASRFAKAWLPFCKKFK 173 Score = 29.6 bits (65), Expect(2) = 6e-11 Identities = 17/35 (48%), Positives = 18/35 (51%) Frame = +3 Query: 663 RYEENLPGVXXXXXXXXXVRRIIEPPIMVINTFFS 767 RYE+ LP V IEPPIMVINT S Sbjct: 96 RYEDKLPNVDIFVCTADPT---IEPPIMVINTVLS 127 >ref|XP_010088429.1| Cellulose synthase-like protein E1 [Morus notabilis] gi|587845497|gb|EXB36044.1| Cellulose synthase-like protein E1 [Morus notabilis] Length = 733 Score = 64.3 bits (155), Expect(2) = 6e-11 Identities = 28/50 (56%), Positives = 38/50 (76%) Frame = +1 Query: 754 TLFLVMAFKYPAENFSLYLSDDGG*EMTFYALLEAFRLAKFWITFGKQYK 903 T+ VMA+ YP + S+YLSDDGG ++TFYALLEA AK+WI + K++K Sbjct: 119 TVLSVMAYDYPQQKLSVYLSDDGGSDLTFYALLEASEFAKYWIPYCKKFK 168 Score = 31.2 bits (69), Expect(2) = 6e-11 Identities = 18/35 (51%), Positives = 18/35 (51%) Frame = +3 Query: 663 RYEENLPGVXXXXXXXXXVRRIIEPPIMVINTFFS 767 RYE LPGV IEPPIMVINT S Sbjct: 91 RYENQLPGVDIFVCTADPT---IEPPIMVINTVLS 122 >ref|XP_009349137.1| PREDICTED: cellulose synthase-like protein E2 [Pyrus x bretschneideri] Length = 248 Score = 65.5 bits (158), Expect(2) = 6e-11 Identities = 30/50 (60%), Positives = 37/50 (74%) Frame = +1 Query: 754 TLFLVMAFKYPAENFSLYLSDDGG*EMTFYALLEAFRLAKFWITFGKQYK 903 T+ VMA+ YP E S+YLSDDGG E+T+YALLEA AK WI + K+YK Sbjct: 119 TVLSVMAYDYPPEKLSVYLSDDGGSELTYYALLEAAEFAKHWIPYCKRYK 168 Score = 30.0 bits (66), Expect(2) = 6e-11 Identities = 17/35 (48%), Positives = 18/35 (51%) Frame = +3 Query: 663 RYEENLPGVXXXXXXXXXVRRIIEPPIMVINTFFS 767 RYE LPGV IEPP+MVINT S Sbjct: 91 RYENELPGVDVFVCTADPT---IEPPMMVINTVLS 122 >ref|XP_007142429.1| hypothetical protein PHAVU_008G279700g [Phaseolus vulgaris] gi|561015562|gb|ESW14423.1| hypothetical protein PHAVU_008G279700g [Phaseolus vulgaris] Length = 1006 Score = 65.1 bits (157), Expect(2) = 1e-10 Identities = 30/50 (60%), Positives = 38/50 (76%) Frame = +1 Query: 754 TLFLVMAFKYPAENFSLYLSDDGG*EMTFYALLEAFRLAKFWITFGKQYK 903 T+ VMA+ YPAE S+YLSDDGG ++TFYALL+A AK WI F K++K Sbjct: 119 TVLSVMAYDYPAEKLSVYLSDDGGSDVTFYALLQASSFAKHWIPFCKRFK 168 Score = 29.6 bits (65), Expect(2) = 1e-10 Identities = 16/35 (45%), Positives = 18/35 (51%) Frame = +3 Query: 663 RYEENLPGVXXXXXXXXXVRRIIEPPIMVINTFFS 767 RYE PGV V +EPP+MVINT S Sbjct: 91 RYESRFPGVDIFVFTADAV---VEPPMMVINTVLS 122 Score = 64.7 bits (156), Expect(2) = 1e-10 Identities = 31/50 (62%), Positives = 37/50 (74%) Frame = +1 Query: 754 TLFLVMAFKYPAENFSLYLSDDGG*EMTFYALLEAFRLAKFWITFGKQYK 903 T+ VMA+ Y AE S+YLSDDGG ++TFYALLEA AK WI F K+YK Sbjct: 849 TVLSVMAYDYAAEKLSVYLSDDGGSDVTFYALLEASSFAKHWIPFCKRYK 898 Score = 29.6 bits (65), Expect(2) = 1e-10 Identities = 16/35 (45%), Positives = 18/35 (51%) Frame = +3 Query: 663 RYEENLPGVXXXXXXXXXVRRIIEPPIMVINTFFS 767 RYE PGV V +EPP+MVINT S Sbjct: 821 RYESRFPGVDIFVFTADAV---VEPPMMVINTVLS 852 >ref|XP_002274290.2| PREDICTED: cellulose synthase-like protein E6 [Vitis vinifera] Length = 746 Score = 64.3 bits (155), Expect(2) = 1e-10 Identities = 27/49 (55%), Positives = 39/49 (79%) Frame = +1 Query: 754 TLFLVMAFKYPAENFSLYLSDDGG*EMTFYALLEAFRLAKFWITFGKQY 900 T+ VMA+ YP++N S+YLSDDGG ++TFYALLEA R +K W+ F +++ Sbjct: 132 TVLSVMAYNYPSQNLSVYLSDDGGSDLTFYALLEASRFSKHWLPFCRKF 180 Score = 30.4 bits (67), Expect(2) = 1e-10 Identities = 18/35 (51%), Positives = 19/35 (54%) Frame = +3 Query: 663 RYEENLPGVXXXXXXXXXVRRIIEPPIMVINTFFS 767 RYEE LPG+ IEPPIMVINT S Sbjct: 104 RYEEVLPGIDIFVCTADPR---IEPPIMVINTVLS 135 >ref|XP_003635361.2| PREDICTED: cellulose synthase-like protein E6 [Vitis vinifera] Length = 742 Score = 64.3 bits (155), Expect(2) = 1e-10 Identities = 27/49 (55%), Positives = 39/49 (79%) Frame = +1 Query: 754 TLFLVMAFKYPAENFSLYLSDDGG*EMTFYALLEAFRLAKFWITFGKQY 900 T+ VMA+ YP++N S+YLSDDGG ++TFYALLEA R +K W+ F +++ Sbjct: 128 TVLSVMAYNYPSQNLSVYLSDDGGSDLTFYALLEASRFSKHWLPFCRKF 176 Score = 30.4 bits (67), Expect(2) = 1e-10 Identities = 18/35 (51%), Positives = 19/35 (54%) Frame = +3 Query: 663 RYEENLPGVXXXXXXXXXVRRIIEPPIMVINTFFS 767 RYEE LPG+ IEPPIMVINT S Sbjct: 100 RYEEVLPGIDIFVCTADPR---IEPPIMVINTVLS 131 >ref|XP_007142428.1| hypothetical protein PHAVU_008G279700g [Phaseolus vulgaris] gi|561015561|gb|ESW14422.1| hypothetical protein PHAVU_008G279700g [Phaseolus vulgaris] Length = 736 Score = 65.1 bits (157), Expect(2) = 1e-10 Identities = 30/50 (60%), Positives = 38/50 (76%) Frame = +1 Query: 754 TLFLVMAFKYPAENFSLYLSDDGG*EMTFYALLEAFRLAKFWITFGKQYK 903 T+ VMA+ YPAE S+YLSDDGG ++TFYALL+A AK WI F K++K Sbjct: 119 TVLSVMAYDYPAEKLSVYLSDDGGSDVTFYALLQASSFAKHWIPFCKRFK 168 Score = 29.6 bits (65), Expect(2) = 1e-10 Identities = 16/35 (45%), Positives = 18/35 (51%) Frame = +3 Query: 663 RYEENLPGVXXXXXXXXXVRRIIEPPIMVINTFFS 767 RYE PGV V +EPP+MVINT S Sbjct: 91 RYESRFPGVDIFVFTADAV---VEPPMMVINTVLS 122 >ref|XP_007142427.1| hypothetical protein PHAVU_008G279700g [Phaseolus vulgaris] gi|561015560|gb|ESW14421.1| hypothetical protein PHAVU_008G279700g [Phaseolus vulgaris] Length = 736 Score = 65.1 bits (157), Expect(2) = 1e-10 Identities = 30/50 (60%), Positives = 38/50 (76%) Frame = +1 Query: 754 TLFLVMAFKYPAENFSLYLSDDGG*EMTFYALLEAFRLAKFWITFGKQYK 903 T+ VMA+ YPAE S+YLSDDGG ++TFYALL+A AK WI F K++K Sbjct: 119 TVLSVMAYDYPAEKLSVYLSDDGGSDVTFYALLQASSFAKHWIPFCKRFK 168 Score = 29.6 bits (65), Expect(2) = 1e-10 Identities = 16/35 (45%), Positives = 18/35 (51%) Frame = +3 Query: 663 RYEENLPGVXXXXXXXXXVRRIIEPPIMVINTFFS 767 RYE PGV V +EPP+MVINT S Sbjct: 91 RYESRFPGVDIFVFTADAV---VEPPMMVINTVLS 122 >ref|XP_003635328.1| PREDICTED: cellulose synthase-like protein E6 [Vitis vinifera] Length = 735 Score = 64.3 bits (155), Expect(2) = 1e-10 Identities = 27/49 (55%), Positives = 39/49 (79%) Frame = +1 Query: 754 TLFLVMAFKYPAENFSLYLSDDGG*EMTFYALLEAFRLAKFWITFGKQY 900 T+ VMA+ YP++N S+YLSDDGG ++TFYALLEA R +K W+ F +++ Sbjct: 121 TVLSVMAYNYPSQNLSVYLSDDGGSDLTFYALLEASRFSKHWLPFCRKF 169 Score = 30.4 bits (67), Expect(2) = 1e-10 Identities = 18/35 (51%), Positives = 19/35 (54%) Frame = +3 Query: 663 RYEENLPGVXXXXXXXXXVRRIIEPPIMVINTFFS 767 RYEE LPG+ IEPPIMVINT S Sbjct: 93 RYEEVLPGIDIFVCTADPR---IEPPIMVINTVLS 124 >ref|XP_008366098.1| PREDICTED: cellulose synthase-like protein E1 isoform X1 [Malus domestica] Length = 731 Score = 64.3 bits (155), Expect(2) = 1e-10 Identities = 30/50 (60%), Positives = 37/50 (74%) Frame = +1 Query: 754 TLFLVMAFKYPAENFSLYLSDDGG*EMTFYALLEAFRLAKFWITFGKQYK 903 T+ VMA+ YP E S+YLSDDGG E+T+YALLEA AK WI + K+YK Sbjct: 116 TVLSVMAYDYPPEKLSVYLSDDGGSEITYYALLEAAEFAKQWIPYCKRYK 165 Score = 30.4 bits (67), Expect(2) = 1e-10 Identities = 17/35 (48%), Positives = 18/35 (51%) Frame = +3 Query: 663 RYEENLPGVXXXXXXXXXVRRIIEPPIMVINTFFS 767 RYE LPGV IEPP+MVINT S Sbjct: 88 RYENELPGVDVFVCTADAT---IEPPLMVINTVLS 119 >ref|XP_008366099.1| PREDICTED: cellulose synthase-like protein E1 isoform X2 [Malus domestica] Length = 684 Score = 64.3 bits (155), Expect(2) = 1e-10 Identities = 30/50 (60%), Positives = 37/50 (74%) Frame = +1 Query: 754 TLFLVMAFKYPAENFSLYLSDDGG*EMTFYALLEAFRLAKFWITFGKQYK 903 T+ VMA+ YP E S+YLSDDGG E+T+YALLEA AK WI + K+YK Sbjct: 116 TVLSVMAYDYPPEKLSVYLSDDGGSEITYYALLEAAEFAKQWIPYCKRYK 165 Score = 30.4 bits (67), Expect(2) = 1e-10 Identities = 17/35 (48%), Positives = 18/35 (51%) Frame = +3 Query: 663 RYEENLPGVXXXXXXXXXVRRIIEPPIMVINTFFS 767 RYE LPGV IEPP+MVINT S Sbjct: 88 RYENELPGVDVFVCTADAT---IEPPLMVINTVLS 119 >emb|CBI23494.3| unnamed protein product [Vitis vinifera] Length = 682 Score = 64.3 bits (155), Expect(2) = 1e-10 Identities = 27/49 (55%), Positives = 39/49 (79%) Frame = +1 Query: 754 TLFLVMAFKYPAENFSLYLSDDGG*EMTFYALLEAFRLAKFWITFGKQY 900 T+ VMA+ YP++N S+YLSDDGG ++TFYALLEA R +K W+ F +++ Sbjct: 128 TVLSVMAYNYPSQNLSVYLSDDGGSDLTFYALLEASRFSKHWLPFCRKF 176 Score = 30.4 bits (67), Expect(2) = 1e-10 Identities = 18/35 (51%), Positives = 19/35 (54%) Frame = +3 Query: 663 RYEENLPGVXXXXXXXXXVRRIIEPPIMVINTFFS 767 RYEE LPG+ IEPPIMVINT S Sbjct: 100 RYEEVLPGIDIFVCTADPR---IEPPIMVINTVLS 131 >emb|CBI29435.3| unnamed protein product [Vitis vinifera] Length = 642 Score = 64.3 bits (155), Expect(2) = 1e-10 Identities = 27/49 (55%), Positives = 39/49 (79%) Frame = +1 Query: 754 TLFLVMAFKYPAENFSLYLSDDGG*EMTFYALLEAFRLAKFWITFGKQY 900 T+ VMA+ YP++N S+YLSDDGG ++TFYALLEA R +K W+ F +++ Sbjct: 65 TVLSVMAYNYPSQNLSVYLSDDGGSDLTFYALLEASRFSKHWLPFCRKF 113 Score = 30.4 bits (67), Expect(2) = 1e-10 Identities = 18/35 (51%), Positives = 19/35 (54%) Frame = +3 Query: 663 RYEENLPGVXXXXXXXXXVRRIIEPPIMVINTFFS 767 RYEE LPG+ IEPPIMVINT S Sbjct: 37 RYEEVLPGIDIFVCTADPR---IEPPIMVINTVLS 68 >emb|CBI23490.3| unnamed protein product [Vitis vinifera] Length = 619 Score = 64.3 bits (155), Expect(2) = 1e-10 Identities = 27/49 (55%), Positives = 39/49 (79%) Frame = +1 Query: 754 TLFLVMAFKYPAENFSLYLSDDGG*EMTFYALLEAFRLAKFWITFGKQY 900 T+ VMA+ YP++N S+YLSDDGG ++TFYALLEA R +K W+ F +++ Sbjct: 65 TVLSVMAYNYPSQNLSVYLSDDGGSDLTFYALLEASRFSKHWLPFCRKF 113 Score = 30.4 bits (67), Expect(2) = 1e-10 Identities = 18/35 (51%), Positives = 19/35 (54%) Frame = +3 Query: 663 RYEENLPGVXXXXXXXXXVRRIIEPPIMVINTFFS 767 RYEE LPG+ IEPPIMVINT S Sbjct: 37 RYEEVLPGIDIFVCTADPR---IEPPIMVINTVLS 68 >ref|XP_008349391.1| PREDICTED: cellulose synthase-like protein E2 [Malus domestica] Length = 396 Score = 64.3 bits (155), Expect(2) = 1e-10 Identities = 30/50 (60%), Positives = 37/50 (74%) Frame = +1 Query: 754 TLFLVMAFKYPAENFSLYLSDDGG*EMTFYALLEAFRLAKFWITFGKQYK 903 T+ VMA+ YP E S+YLSDDGG E+T+YALLEA AK WI + K+YK Sbjct: 116 TVLSVMAYDYPPEKLSVYLSDDGGSEITYYALLEAAEFAKQWIPYCKRYK 165 Score = 30.4 bits (67), Expect(2) = 1e-10 Identities = 17/35 (48%), Positives = 18/35 (51%) Frame = +3 Query: 663 RYEENLPGVXXXXXXXXXVRRIIEPPIMVINTFFS 767 RYE LPGV IEPP+MVINT S Sbjct: 88 RYENELPGVDVFVCTADAT---IEPPLMVINTVLS 119