BLASTX nr result
ID: Papaver30_contig00031170
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver30_contig00031170 (730 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012077365.1| PREDICTED: nuclear pore complex protein NUP8... 59 3e-06 ref|XP_010102397.1| hypothetical protein L484_010709 [Morus nota... 58 6e-06 ref|XP_002283798.1| PREDICTED: nuclear pore complex protein NUP8... 57 1e-05 >ref|XP_012077365.1| PREDICTED: nuclear pore complex protein NUP85 [Jatropha curcas] gi|643724954|gb|KDP34155.1| hypothetical protein JCGZ_07726 [Jatropha curcas] Length = 724 Score = 58.9 bits (141), Expect = 3e-06 Identities = 26/43 (60%), Positives = 36/43 (83%) Frame = -1 Query: 283 HALLMALSISSIQIAPVYLMSCMKQGIALLEILLYKQPVQHNR 155 +A +++ I + QIAP+YL+SCMKQG+ LLEIL Y+QPVQHN+ Sbjct: 473 YAQVLSSHILTWQIAPIYLISCMKQGMGLLEILFYRQPVQHNQ 515 >ref|XP_010102397.1| hypothetical protein L484_010709 [Morus notabilis] gi|587905197|gb|EXB93382.1| hypothetical protein L484_010709 [Morus notabilis] Length = 692 Score = 58.2 bits (139), Expect = 6e-06 Identities = 27/42 (64%), Positives = 35/42 (83%) Frame = -1 Query: 283 HALLMALSISSIQIAPVYLMSCMKQGIALLEILLYKQPVQHN 158 +A ++A + + QIAPVYL+SCMKQG+ LLE+LL KQPVQHN Sbjct: 442 YAQVLASHVLTWQIAPVYLISCMKQGMGLLELLLCKQPVQHN 483 >ref|XP_002283798.1| PREDICTED: nuclear pore complex protein NUP85 [Vitis vinifera] gi|731385412|ref|XP_010648493.1| PREDICTED: nuclear pore complex protein NUP85 [Vitis vinifera] gi|296081842|emb|CBI20847.3| unnamed protein product [Vitis vinifera] Length = 715 Score = 57.4 bits (137), Expect = 1e-05 Identities = 31/55 (56%), Positives = 39/55 (70%), Gaps = 4/55 (7%) Frame = -1 Query: 283 HALLMALSISSI----QIAPVYLMSCMKQGIALLEILLYKQPVQHNR*QIQLTFI 131 H L+ A +SS QIAP+YL SCMKQG+ LLE+LLYKQPVQ N+ ++ T I Sbjct: 461 HRLIYAQVLSSHALTWQIAPIYLTSCMKQGMGLLEVLLYKQPVQDNQMLLKTTEI 515