BLASTX nr result
ID: Papaver30_contig00030708
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver30_contig00030708 (511 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012841982.1| PREDICTED: calcium-dependent protein kinase-... 76 9e-12 ref|XP_010538709.1| PREDICTED: calcium-dependent protein kinase ... 75 1e-11 ref|XP_010467929.1| PREDICTED: calcium-dependent protein kinase ... 75 1e-11 ref|XP_009360846.1| PREDICTED: calcium-dependent protein kinase ... 75 1e-11 gb|KFK30983.1| hypothetical protein AALP_AA6G053500 [Arabis alpina] 75 1e-11 ref|XP_008345823.1| PREDICTED: calcium-dependent protein kinase ... 75 1e-11 ref|NP_192381.1| calcium-dependent protein kinase 21 [Arabidopsi... 75 1e-11 ref|NP_001280761.1| calcium-dependent protein kinase 2-like [Mal... 75 1e-11 gb|AAK92828.1| putative calcium dependent protein kinase [Arabid... 75 1e-11 ref|XP_010276092.1| PREDICTED: calcium-dependent protein kinase ... 75 3e-11 ref|XP_009357448.1| PREDICTED: calcium-dependent protein kinase ... 75 3e-11 ref|XP_013692244.1| PREDICTED: calcium-dependent protein kinase ... 74 3e-11 ref|XP_010529441.1| PREDICTED: calcium-dependent protein kinase ... 74 3e-11 ref|XP_010455773.1| PREDICTED: calcium-dependent protein kinase ... 74 3e-11 ref|XP_010422295.1| PREDICTED: calcium-dependent protein kinase ... 74 3e-11 ref|XP_009144515.1| PREDICTED: calcium-dependent protein kinase ... 74 3e-11 ref|XP_008384073.1| PREDICTED: calcium-dependent protein kinase ... 74 3e-11 ref|XP_006396672.1| hypothetical protein EUTSA_v10028567mg [Eutr... 74 3e-11 ref|XP_006289661.1| hypothetical protein CARUB_v10003219mg [Caps... 74 3e-11 ref|XP_002874811.1| calcium-dependent protein kinase 21 [Arabido... 74 3e-11 >ref|XP_012841982.1| PREDICTED: calcium-dependent protein kinase-like [Erythranthe guttatus] gi|604328223|gb|EYU33891.1| hypothetical protein MIMGU_mgv1a004201mg [Erythranthe guttata] Length = 539 Score = 76.3 bits (186), Expect = 9e-12 Identities = 35/43 (81%), Positives = 38/43 (88%) Frame = -1 Query: 511 GMGDEESIREIISEVDADNDGRINYEEFCAMMRGGSQQPAVKL 383 GMGDE +I EIISEVD DNDG+INYEEFCAMMR G+ QPAVKL Sbjct: 496 GMGDEATIEEIISEVDTDNDGKINYEEFCAMMRSGTTQPAVKL 538 >ref|XP_010538709.1| PREDICTED: calcium-dependent protein kinase 21-like [Tarenaya hassleriana] Length = 545 Score = 75.5 bits (184), Expect = 1e-11 Identities = 35/43 (81%), Positives = 37/43 (86%) Frame = -1 Query: 511 GMGDEESIREIISEVDADNDGRINYEEFCAMMRGGSQQPAVKL 383 GMGDE SIRE+I+EVD DNDGRINYEEFCAMMR GS QP KL Sbjct: 499 GMGDEASIREVIAEVDTDNDGRINYEEFCAMMRSGSTQPEGKL 541 >ref|XP_010467929.1| PREDICTED: calcium-dependent protein kinase 21-like [Camelina sativa] Length = 873 Score = 75.5 bits (184), Expect = 1e-11 Identities = 35/46 (76%), Positives = 39/46 (84%) Frame = -1 Query: 511 GMGDEESIREIISEVDADNDGRINYEEFCAMMRGGSQQPAVKLI*F 374 GMGDE SIRE+ISEVD DNDG+IN+EEFCAMMR GS QP KL+ F Sbjct: 827 GMGDEASIREVISEVDTDNDGKINFEEFCAMMRSGSTQPQGKLLPF 872 >ref|XP_009360846.1| PREDICTED: calcium-dependent protein kinase 2-like [Pyrus x bretschneideri] Length = 543 Score = 75.5 bits (184), Expect = 1e-11 Identities = 34/40 (85%), Positives = 37/40 (92%) Frame = -1 Query: 511 GMGDEESIREIISEVDADNDGRINYEEFCAMMRGGSQQPA 392 GMGD+ +IREIISEVDADNDGRINY EFCAMMR G+QQPA Sbjct: 501 GMGDDNTIREIISEVDADNDGRINYSEFCAMMRSGAQQPA 540 >gb|KFK30983.1| hypothetical protein AALP_AA6G053500 [Arabis alpina] Length = 538 Score = 75.5 bits (184), Expect = 1e-11 Identities = 35/46 (76%), Positives = 39/46 (84%) Frame = -1 Query: 511 GMGDEESIREIISEVDADNDGRINYEEFCAMMRGGSQQPAVKLI*F 374 GMGDE SI+E+ISEVD DNDGRIN+EEFCAMMR GS QP KL+ F Sbjct: 492 GMGDEASIKEVISEVDTDNDGRINFEEFCAMMRSGSTQPQNKLLPF 537 >ref|XP_008345823.1| PREDICTED: calcium-dependent protein kinase 2-like [Malus domestica] Length = 103 Score = 75.5 bits (184), Expect = 1e-11 Identities = 34/40 (85%), Positives = 37/40 (92%) Frame = -1 Query: 511 GMGDEESIREIISEVDADNDGRINYEEFCAMMRGGSQQPA 392 GMGD+ +IREIISEVDADNDGRINY EFCAMMR G+QQPA Sbjct: 61 GMGDDNTIREIISEVDADNDGRINYSEFCAMMRSGAQQPA 100 >ref|NP_192381.1| calcium-dependent protein kinase 21 [Arabidopsis thaliana] gi|75338954|sp|Q9ZSA2.1|CDPKL_ARATH RecName: Full=Calcium-dependent protein kinase 21 gi|4115943|gb|AAD03453.1| contains similarity to eukaryotic protein kinase domains (Pfam: PF00069, score=312.6, E=4.7e-90, N=1) and EF hand domains (Pfam: PF00036, score=131, E=2.1e-35, N=4) [Arabidopsis thaliana] gi|7267230|emb|CAB80837.1| putative calcium dependent protein kinase [Arabidopsis thaliana] gi|23297753|gb|AAN13018.1| putative calcium-dependent protein kinase [Arabidopsis thaliana] gi|332657016|gb|AEE82416.1| calcium-dependent protein kinase 21 [Arabidopsis thaliana] Length = 531 Score = 75.5 bits (184), Expect = 1e-11 Identities = 35/46 (76%), Positives = 39/46 (84%) Frame = -1 Query: 511 GMGDEESIREIISEVDADNDGRINYEEFCAMMRGGSQQPAVKLI*F 374 GMGDE SI+E+ISEVD DNDGRIN+EEFCAMMR GS QP KL+ F Sbjct: 485 GMGDEASIKEVISEVDTDNDGRINFEEFCAMMRSGSTQPQGKLLPF 530 >ref|NP_001280761.1| calcium-dependent protein kinase 2-like [Malus domestica] gi|39546555|gb|AAR28084.1| calcium-dependent protein kinase [Malus domestica] Length = 543 Score = 75.5 bits (184), Expect = 1e-11 Identities = 34/40 (85%), Positives = 37/40 (92%) Frame = -1 Query: 511 GMGDEESIREIISEVDADNDGRINYEEFCAMMRGGSQQPA 392 GMGD+ +IREIISEVDADNDGRINY EFCAMMR G+QQPA Sbjct: 501 GMGDDNTIREIISEVDADNDGRINYSEFCAMMRSGAQQPA 540 >gb|AAK92828.1| putative calcium dependent protein kinase [Arabidopsis thaliana] Length = 531 Score = 75.5 bits (184), Expect = 1e-11 Identities = 35/46 (76%), Positives = 39/46 (84%) Frame = -1 Query: 511 GMGDEESIREIISEVDADNDGRINYEEFCAMMRGGSQQPAVKLI*F 374 GMGDE SI+E+ISEVD DNDGRIN+EEFCAMMR GS QP KL+ F Sbjct: 485 GMGDEASIKEVISEVDTDNDGRINFEEFCAMMRSGSTQPQGKLLPF 530 >ref|XP_010276092.1| PREDICTED: calcium-dependent protein kinase 2-like [Nelumbo nucifera] Length = 538 Score = 74.7 bits (182), Expect = 3e-11 Identities = 37/44 (84%), Positives = 38/44 (86%) Frame = -1 Query: 511 GMGDEESIREIISEVDADNDGRINYEEFCAMMRGGSQQPAVKLI 380 GMGDE SI+EIISEVD DNDGRINYEEFC MMR G QQP VKLI Sbjct: 496 GMGDEASIKEIISEVDTDNDGRINYEEFCTMMRSGMQQP-VKLI 538 >ref|XP_009357448.1| PREDICTED: calcium-dependent protein kinase 2-like [Pyrus x bretschneideri] Length = 546 Score = 74.7 bits (182), Expect = 3e-11 Identities = 33/41 (80%), Positives = 38/41 (92%) Frame = -1 Query: 511 GMGDEESIREIISEVDADNDGRINYEEFCAMMRGGSQQPAV 389 GMGD+ +IREIISEVDADNDG+INY EFCAMMR G+QQPA+ Sbjct: 504 GMGDDNTIREIISEVDADNDGKINYSEFCAMMRSGTQQPAM 544 >ref|XP_013692244.1| PREDICTED: calcium-dependent protein kinase 21 [Brassica napus] gi|923913282|ref|XP_013726308.1| PREDICTED: calcium-dependent protein kinase 21 [Brassica napus] Length = 525 Score = 74.3 bits (181), Expect = 3e-11 Identities = 34/46 (73%), Positives = 39/46 (84%) Frame = -1 Query: 511 GMGDEESIREIISEVDADNDGRINYEEFCAMMRGGSQQPAVKLI*F 374 GMGDE SI+E+ISEVD DNDGRIN+EEFCAMMR G+ QP KL+ F Sbjct: 479 GMGDEASIKEVISEVDTDNDGRINFEEFCAMMRSGTTQPQGKLLPF 524 >ref|XP_010529441.1| PREDICTED: calcium-dependent protein kinase 21 [Tarenaya hassleriana] Length = 544 Score = 74.3 bits (181), Expect = 3e-11 Identities = 33/43 (76%), Positives = 38/43 (88%) Frame = -1 Query: 511 GMGDEESIREIISEVDADNDGRINYEEFCAMMRGGSQQPAVKL 383 GMGDE+SIRE+I+EVD DNDGRINY+EFCAMMR G+ QP KL Sbjct: 498 GMGDEDSIREVIAEVDTDNDGRINYQEFCAMMRSGTTQPQGKL 540 >ref|XP_010455773.1| PREDICTED: calcium-dependent protein kinase 21-like [Camelina sativa] Length = 536 Score = 74.3 bits (181), Expect = 3e-11 Identities = 34/46 (73%), Positives = 39/46 (84%) Frame = -1 Query: 511 GMGDEESIREIISEVDADNDGRINYEEFCAMMRGGSQQPAVKLI*F 374 GMGDE SI+E+ISEVD DNDG+IN+EEFCAMMR GS QP KL+ F Sbjct: 490 GMGDEASIKEVISEVDTDNDGKINFEEFCAMMRSGSTQPQGKLLPF 535 >ref|XP_010422295.1| PREDICTED: calcium-dependent protein kinase 21 [Camelina sativa] Length = 534 Score = 74.3 bits (181), Expect = 3e-11 Identities = 34/46 (73%), Positives = 39/46 (84%) Frame = -1 Query: 511 GMGDEESIREIISEVDADNDGRINYEEFCAMMRGGSQQPAVKLI*F 374 GMGDE SI+E+ISEVD DNDG+IN+EEFCAMMR GS QP KL+ F Sbjct: 488 GMGDEASIKEVISEVDTDNDGKINFEEFCAMMRSGSTQPQGKLLPF 533 >ref|XP_009144515.1| PREDICTED: calcium-dependent protein kinase 21 [Brassica rapa] gi|674936125|emb|CDX97315.1| BnaA02g21060D [Brassica napus] Length = 520 Score = 74.3 bits (181), Expect = 3e-11 Identities = 34/46 (73%), Positives = 39/46 (84%) Frame = -1 Query: 511 GMGDEESIREIISEVDADNDGRINYEEFCAMMRGGSQQPAVKLI*F 374 GMGDE SI+E+ISEVD DNDGRIN+EEFCAMMR G+ QP KL+ F Sbjct: 474 GMGDEASIKEVISEVDTDNDGRINFEEFCAMMRSGTTQPQGKLLPF 519 >ref|XP_008384073.1| PREDICTED: calcium-dependent protein kinase 33-like [Malus domestica] Length = 397 Score = 74.3 bits (181), Expect = 3e-11 Identities = 33/40 (82%), Positives = 37/40 (92%) Frame = -1 Query: 511 GMGDEESIREIISEVDADNDGRINYEEFCAMMRGGSQQPA 392 GMGD+ +IREIISEVDADNDG+INY EFCAMMR G+QQPA Sbjct: 355 GMGDDNTIREIISEVDADNDGKINYSEFCAMMRSGTQQPA 394 >ref|XP_006396672.1| hypothetical protein EUTSA_v10028567mg [Eutrema salsugineum] gi|557097689|gb|ESQ38125.1| hypothetical protein EUTSA_v10028567mg [Eutrema salsugineum] Length = 535 Score = 74.3 bits (181), Expect = 3e-11 Identities = 34/46 (73%), Positives = 39/46 (84%) Frame = -1 Query: 511 GMGDEESIREIISEVDADNDGRINYEEFCAMMRGGSQQPAVKLI*F 374 GMGDE SI+E+ISEVD DNDGRIN+EEFCAMMR G+ QP KL+ F Sbjct: 489 GMGDEASIKEVISEVDTDNDGRINFEEFCAMMRSGTTQPQGKLLPF 534 >ref|XP_006289661.1| hypothetical protein CARUB_v10003219mg [Capsella rubella] gi|482558367|gb|EOA22559.1| hypothetical protein CARUB_v10003219mg [Capsella rubella] Length = 534 Score = 74.3 bits (181), Expect = 3e-11 Identities = 34/46 (73%), Positives = 39/46 (84%) Frame = -1 Query: 511 GMGDEESIREIISEVDADNDGRINYEEFCAMMRGGSQQPAVKLI*F 374 GMGDE SI+E+ISEVD DNDGRIN+EEFCAMMR G+ QP KL+ F Sbjct: 488 GMGDEASIKEVISEVDTDNDGRINFEEFCAMMRSGTTQPQGKLLPF 533 >ref|XP_002874811.1| calcium-dependent protein kinase 21 [Arabidopsis lyrata subsp. lyrata] gi|297320648|gb|EFH51070.1| calcium-dependent protein kinase 21 [Arabidopsis lyrata subsp. lyrata] Length = 534 Score = 74.3 bits (181), Expect = 3e-11 Identities = 34/46 (73%), Positives = 39/46 (84%) Frame = -1 Query: 511 GMGDEESIREIISEVDADNDGRINYEEFCAMMRGGSQQPAVKLI*F 374 GMGDE SI+E+ISEVD DNDGRIN+EEFCAMMR G+ QP KL+ F Sbjct: 488 GMGDEASIKEVISEVDTDNDGRINFEEFCAMMRSGTTQPQGKLLPF 533