BLASTX nr result
ID: Papaver30_contig00030079
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver30_contig00030079 (461 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009395565.1| PREDICTED: lisH domain and HEAT repeat-conta... 48 2e-06 ref|XP_010279364.1| PREDICTED: lisH domain and HEAT repeat-conta... 51 7e-06 >ref|XP_009395565.1| PREDICTED: lisH domain and HEAT repeat-containing protein KIAA1468 homolog [Musa acuminata subsp. malaccensis] Length = 1199 Score = 47.8 bits (112), Expect(3) = 2e-06 Identities = 21/32 (65%), Positives = 24/32 (75%) Frame = -1 Query: 455 GERERWNVEVLLRMLTKLFPFVHRK*LRLAHF 360 GERE WN++VLLRMLT L PFVHRK + F Sbjct: 698 GEREHWNIDVLLRMLTGLLPFVHRKAIETCPF 729 Score = 25.0 bits (53), Expect(3) = 2e-06 Identities = 11/15 (73%), Positives = 11/15 (73%) Frame = -3 Query: 384 KVIETCSFPSAMRSL 340 K IETC F SAM SL Sbjct: 722 KAIETCPFSSAMESL 736 Score = 24.3 bits (51), Expect(3) = 2e-06 Identities = 11/27 (40%), Positives = 16/27 (59%) Frame = -2 Query: 349 EISSASSETRGFFTISLFELYAGYVTL 269 E + S + FF+ SL +LYAG T+ Sbjct: 734 ESLTTSEQQNSFFSTSLLQLYAGGRTI 760 >ref|XP_010279364.1| PREDICTED: lisH domain and HEAT repeat-containing protein KIAA1468 homolog [Nelumbo nucifera] Length = 1184 Score = 50.8 bits (120), Expect(2) = 7e-06 Identities = 22/33 (66%), Positives = 26/33 (78%) Frame = -1 Query: 455 GERERWNVEVLLRMLTKLFPFVHRK*LRLAHFP 357 GERERWN++VLLRMLT L PFVH+K + FP Sbjct: 691 GERERWNIDVLLRMLTDLLPFVHQKAIESCPFP 723 Score = 25.4 bits (54), Expect(2) = 7e-06 Identities = 12/21 (57%), Positives = 14/21 (66%) Frame = -2 Query: 343 SSASSETRGFFTISLFELYAG 281 S AS FF+IS+ ELYAG Sbjct: 728 SLASDPQGAFFSISVLELYAG 748