BLASTX nr result
ID: Papaver30_contig00028959
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver30_contig00028959 (800 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011627374.1| PREDICTED: CTP synthase isoform X2 [Amborell... 72 6e-10 ref|XP_006855319.1| PREDICTED: CTP synthase isoform X1 [Amborell... 72 6e-10 ref|XP_007022789.1| CTP synthase family protein [Theobroma cacao... 72 6e-10 ref|XP_009775937.1| PREDICTED: CTP synthase-like [Nicotiana sylv... 71 1e-09 ref|XP_009592741.1| PREDICTED: CTP synthase-like isoform X3 [Nic... 71 1e-09 ref|XP_009592740.1| PREDICTED: CTP synthase-like isoform X2 [Nic... 71 1e-09 ref|XP_009592739.1| PREDICTED: CTP synthase-like isoform X1 [Nic... 71 1e-09 ref|XP_011659387.1| PREDICTED: CTP synthase isoform X2 [Cucumis ... 70 2e-09 ref|XP_011659386.1| PREDICTED: CTP synthase isoform X1 [Cucumis ... 70 2e-09 ref|XP_009604497.1| PREDICTED: CTP synthase [Nicotiana tomentosi... 70 2e-09 ref|XP_008451511.1| PREDICTED: CTP synthase isoform X3 [Cucumis ... 70 2e-09 ref|XP_008451510.1| PREDICTED: CTP synthase isoform X2 [Cucumis ... 70 2e-09 ref|XP_008451507.1| PREDICTED: CTP synthase isoform X1 [Cucumis ... 70 2e-09 ref|XP_012463613.1| PREDICTED: CTP synthase-like [Gossypium raim... 70 2e-09 gb|KHN30656.1| CTP synthase [Glycine soja] gi|947083106|gb|KRH31... 70 2e-09 gb|KHG10548.1| CTP synthase 1 [Gossypium arboreum] 70 2e-09 ref|NP_001238142.1| uncharacterized protein LOC100500185 [Glycin... 70 2e-09 gb|KJB81465.1| hypothetical protein B456_013G146900 [Gossypium r... 69 3e-09 ref|XP_012463837.1| PREDICTED: CTP synthase [Gossypium raimondii... 69 3e-09 gb|KDO48490.1| hypothetical protein CISIN_1g008567mg [Citrus sin... 69 3e-09 >ref|XP_011627374.1| PREDICTED: CTP synthase isoform X2 [Amborella trichopoda] Length = 554 Score = 71.6 bits (174), Expect = 6e-10 Identities = 31/43 (72%), Positives = 37/43 (86%) Frame = -2 Query: 325 VNPK*TDKFEAADLKFVGRDESGKRMEIVELPSHPFYVGVQFH 197 VNP+ D+ E A LKF G+DESGKRME++ELPSHP+YVGVQFH Sbjct: 480 VNPEIVDRIEDAGLKFTGKDESGKRMEVLELPSHPYYVGVQFH 522 >ref|XP_006855319.1| PREDICTED: CTP synthase isoform X1 [Amborella trichopoda] gi|548859085|gb|ERN16786.1| hypothetical protein AMTR_s00057p00080050 [Amborella trichopoda] Length = 557 Score = 71.6 bits (174), Expect = 6e-10 Identities = 31/43 (72%), Positives = 37/43 (86%) Frame = -2 Query: 325 VNPK*TDKFEAADLKFVGRDESGKRMEIVELPSHPFYVGVQFH 197 VNP+ D+ E A LKF G+DESGKRME++ELPSHP+YVGVQFH Sbjct: 483 VNPEIVDRIEDAGLKFTGKDESGKRMEVLELPSHPYYVGVQFH 525 >ref|XP_007022789.1| CTP synthase family protein [Theobroma cacao] gi|508722417|gb|EOY14314.1| CTP synthase family protein [Theobroma cacao] Length = 603 Score = 71.6 bits (174), Expect = 6e-10 Identities = 32/43 (74%), Positives = 37/43 (86%) Frame = -2 Query: 325 VNPK*TDKFEAADLKFVGRDESGKRMEIVELPSHPFYVGVQFH 197 VNP +FEAA L FVGRDESG+RMEIVELPSHP+++GVQFH Sbjct: 483 VNPDMISQFEAAGLSFVGRDESGRRMEIVELPSHPYFIGVQFH 525 >ref|XP_009775937.1| PREDICTED: CTP synthase-like [Nicotiana sylvestris] Length = 602 Score = 70.9 bits (172), Expect = 1e-09 Identities = 32/43 (74%), Positives = 35/43 (81%) Frame = -2 Query: 325 VNPK*TDKFEAADLKFVGRDESGKRMEIVELPSHPFYVGVQFH 197 VNP+ E A LKFVGRDESGKRMEI+ELP HPFY+GVQFH Sbjct: 517 VNPEIVGSLEEAGLKFVGRDESGKRMEILELPDHPFYIGVQFH 559 Score = 55.8 bits (133), Expect(2) = 1e-06 Identities = 25/32 (78%), Positives = 29/32 (90%) Frame = -3 Query: 777 AQEHMGSTMRLGSRRTLFQTTDCITSKLYDTS 682 ++ HMGSTMRLGSRRTLFQT DCIT+KLY+ S Sbjct: 473 SKTHMGSTMRLGSRRTLFQTPDCITAKLYNNS 504 Score = 24.6 bits (52), Expect(2) = 1e-06 Identities = 9/17 (52%), Positives = 14/17 (82%) Frame = -2 Query: 577 DNYSHVDQRNCHRYEVS 527 +N +VD+R+ HRYEV+ Sbjct: 502 NNSEYVDERHRHRYEVN 518 >ref|XP_009592741.1| PREDICTED: CTP synthase-like isoform X3 [Nicotiana tomentosiformis] Length = 613 Score = 70.9 bits (172), Expect = 1e-09 Identities = 32/43 (74%), Positives = 35/43 (81%) Frame = -2 Query: 325 VNPK*TDKFEAADLKFVGRDESGKRMEIVELPSHPFYVGVQFH 197 VNP+ E A LKFVGRDESGKRMEI+ELP HPFY+GVQFH Sbjct: 528 VNPEIVGSLEEAGLKFVGRDESGKRMEILELPDHPFYIGVQFH 570 Score = 55.8 bits (133), Expect(2) = 1e-06 Identities = 25/32 (78%), Positives = 29/32 (90%) Frame = -3 Query: 777 AQEHMGSTMRLGSRRTLFQTTDCITSKLYDTS 682 ++ HMGSTMRLGSRRTLFQT DCIT+KLY+ S Sbjct: 484 SKTHMGSTMRLGSRRTLFQTPDCITAKLYNNS 515 Score = 24.6 bits (52), Expect(2) = 1e-06 Identities = 9/17 (52%), Positives = 14/17 (82%) Frame = -2 Query: 577 DNYSHVDQRNCHRYEVS 527 +N +VD+R+ HRYEV+ Sbjct: 513 NNSEYVDERHRHRYEVN 529 >ref|XP_009592740.1| PREDICTED: CTP synthase-like isoform X2 [Nicotiana tomentosiformis] Length = 619 Score = 70.9 bits (172), Expect = 1e-09 Identities = 32/43 (74%), Positives = 35/43 (81%) Frame = -2 Query: 325 VNPK*TDKFEAADLKFVGRDESGKRMEIVELPSHPFYVGVQFH 197 VNP+ E A LKFVGRDESGKRMEI+ELP HPFY+GVQFH Sbjct: 534 VNPEIVGSLEEAGLKFVGRDESGKRMEILELPDHPFYIGVQFH 576 Score = 55.8 bits (133), Expect(2) = 1e-06 Identities = 25/32 (78%), Positives = 29/32 (90%) Frame = -3 Query: 777 AQEHMGSTMRLGSRRTLFQTTDCITSKLYDTS 682 ++ HMGSTMRLGSRRTLFQT DCIT+KLY+ S Sbjct: 490 SKTHMGSTMRLGSRRTLFQTPDCITAKLYNNS 521 Score = 24.6 bits (52), Expect(2) = 1e-06 Identities = 9/17 (52%), Positives = 14/17 (82%) Frame = -2 Query: 577 DNYSHVDQRNCHRYEVS 527 +N +VD+R+ HRYEV+ Sbjct: 519 NNSEYVDERHRHRYEVN 535 >ref|XP_009592739.1| PREDICTED: CTP synthase-like isoform X1 [Nicotiana tomentosiformis] Length = 623 Score = 70.9 bits (172), Expect = 1e-09 Identities = 32/43 (74%), Positives = 35/43 (81%) Frame = -2 Query: 325 VNPK*TDKFEAADLKFVGRDESGKRMEIVELPSHPFYVGVQFH 197 VNP+ E A LKFVGRDESGKRMEI+ELP HPFY+GVQFH Sbjct: 538 VNPEIVGSLEEAGLKFVGRDESGKRMEILELPDHPFYIGVQFH 580 Score = 55.8 bits (133), Expect(2) = 1e-06 Identities = 25/32 (78%), Positives = 29/32 (90%) Frame = -3 Query: 777 AQEHMGSTMRLGSRRTLFQTTDCITSKLYDTS 682 ++ HMGSTMRLGSRRTLFQT DCIT+KLY+ S Sbjct: 494 SKTHMGSTMRLGSRRTLFQTPDCITAKLYNNS 525 Score = 24.6 bits (52), Expect(2) = 1e-06 Identities = 9/17 (52%), Positives = 14/17 (82%) Frame = -2 Query: 577 DNYSHVDQRNCHRYEVS 527 +N +VD+R+ HRYEV+ Sbjct: 523 NNSEYVDERHRHRYEVN 539 >ref|XP_011659387.1| PREDICTED: CTP synthase isoform X2 [Cucumis sativus] Length = 514 Score = 70.1 bits (170), Expect = 2e-09 Identities = 32/43 (74%), Positives = 36/43 (83%) Frame = -2 Query: 325 VNPK*TDKFEAADLKFVGRDESGKRMEIVELPSHPFYVGVQFH 197 VNP+ FE A LKFVG+DE+G RMEI+ELPSHPFYVGVQFH Sbjct: 436 VNPESIGAFEEAGLKFVGKDETGNRMEILELPSHPFYVGVQFH 478 >ref|XP_011659386.1| PREDICTED: CTP synthase isoform X1 [Cucumis sativus] gi|700189765|gb|KGN44998.1| hypothetical protein Csa_7G407510 [Cucumis sativus] Length = 561 Score = 70.1 bits (170), Expect = 2e-09 Identities = 32/43 (74%), Positives = 36/43 (83%) Frame = -2 Query: 325 VNPK*TDKFEAADLKFVGRDESGKRMEIVELPSHPFYVGVQFH 197 VNP+ FE A LKFVG+DE+G RMEI+ELPSHPFYVGVQFH Sbjct: 483 VNPESIGAFEEAGLKFVGKDETGNRMEILELPSHPFYVGVQFH 525 >ref|XP_009604497.1| PREDICTED: CTP synthase [Nicotiana tomentosiformis] Length = 562 Score = 70.1 bits (170), Expect = 2e-09 Identities = 33/46 (71%), Positives = 36/46 (78%) Frame = -2 Query: 325 VNPK*TDKFEAADLKFVGRDESGKRMEIVELPSHPFYVGVQFHFMY 188 VNP+ E A L+FVGRDESGKRMEI+ELP HPFYVGVQFH Y Sbjct: 483 VNPEVVGTLEEAGLRFVGRDESGKRMEILELPGHPFYVGVQFHPEY 528 Score = 56.2 bits (134), Expect(2) = 9e-07 Identities = 26/32 (81%), Positives = 28/32 (87%) Frame = -3 Query: 777 AQEHMGSTMRLGSRRTLFQTTDCITSKLYDTS 682 ++ HMGSTMRLGSRRTLFQT DCITSKLY S Sbjct: 439 SKTHMGSTMRLGSRRTLFQTPDCITSKLYHNS 470 Score = 24.6 bits (52), Expect(2) = 9e-07 Identities = 11/23 (47%), Positives = 15/23 (65%) Frame = -2 Query: 595 ICSIYIDNYSHVDQRNCHRYEVS 527 I S N +VD+R+ HRYEV+ Sbjct: 462 ITSKLYHNSKYVDERHRHRYEVN 484 >ref|XP_008451511.1| PREDICTED: CTP synthase isoform X3 [Cucumis melo] Length = 516 Score = 70.1 bits (170), Expect = 2e-09 Identities = 32/43 (74%), Positives = 36/43 (83%) Frame = -2 Query: 325 VNPK*TDKFEAADLKFVGRDESGKRMEIVELPSHPFYVGVQFH 197 VNP+ FE A LKFVG+DE+G RMEI+ELPSHPFYVGVQFH Sbjct: 438 VNPEFIGAFEEAGLKFVGKDETGNRMEILELPSHPFYVGVQFH 480 >ref|XP_008451510.1| PREDICTED: CTP synthase isoform X2 [Cucumis melo] Length = 561 Score = 70.1 bits (170), Expect = 2e-09 Identities = 32/43 (74%), Positives = 36/43 (83%) Frame = -2 Query: 325 VNPK*TDKFEAADLKFVGRDESGKRMEIVELPSHPFYVGVQFH 197 VNP+ FE A LKFVG+DE+G RMEI+ELPSHPFYVGVQFH Sbjct: 483 VNPEFIGAFEEAGLKFVGKDETGNRMEILELPSHPFYVGVQFH 525 >ref|XP_008451507.1| PREDICTED: CTP synthase isoform X1 [Cucumis melo] gi|659101252|ref|XP_008451508.1| PREDICTED: CTP synthase isoform X1 [Cucumis melo] gi|659101254|ref|XP_008451509.1| PREDICTED: CTP synthase isoform X1 [Cucumis melo] Length = 563 Score = 70.1 bits (170), Expect = 2e-09 Identities = 32/43 (74%), Positives = 36/43 (83%) Frame = -2 Query: 325 VNPK*TDKFEAADLKFVGRDESGKRMEIVELPSHPFYVGVQFH 197 VNP+ FE A LKFVG+DE+G RMEI+ELPSHPFYVGVQFH Sbjct: 485 VNPEFIGAFEEAGLKFVGKDETGNRMEILELPSHPFYVGVQFH 527 >ref|XP_012463613.1| PREDICTED: CTP synthase-like [Gossypium raimondii] gi|823132672|ref|XP_012463622.1| PREDICTED: CTP synthase-like [Gossypium raimondii] gi|763746676|gb|KJB14115.1| hypothetical protein B456_002G110800 [Gossypium raimondii] Length = 603 Score = 69.7 bits (169), Expect = 2e-09 Identities = 31/43 (72%), Positives = 36/43 (83%) Frame = -2 Query: 325 VNPK*TDKFEAADLKFVGRDESGKRMEIVELPSHPFYVGVQFH 197 VNP + EAA + FVGRDESG+RMEIVELPSHPF++GVQFH Sbjct: 483 VNPDMISELEAAGMSFVGRDESGRRMEIVELPSHPFFIGVQFH 525 >gb|KHN30656.1| CTP synthase [Glycine soja] gi|947083106|gb|KRH31827.1| hypothetical protein GLYMA_10G014900 [Glycine max] Length = 561 Score = 69.7 bits (169), Expect = 2e-09 Identities = 32/43 (74%), Positives = 35/43 (81%) Frame = -2 Query: 325 VNPK*TDKFEAADLKFVGRDESGKRMEIVELPSHPFYVGVQFH 197 VNP + E A LKFVG+DESGKRMEI+ELPSHPFYVG QFH Sbjct: 483 VNPDVIETLEEAGLKFVGKDESGKRMEILELPSHPFYVGAQFH 525 Score = 54.7 bits (130), Expect(2) = 3e-06 Identities = 25/32 (78%), Positives = 28/32 (87%) Frame = -3 Query: 777 AQEHMGSTMRLGSRRTLFQTTDCITSKLYDTS 682 ++ HMGSTMRLGSRRTL QT+DCITSKLY S Sbjct: 439 SRTHMGSTMRLGSRRTLLQTSDCITSKLYGNS 470 Score = 24.6 bits (52), Expect(2) = 3e-06 Identities = 11/23 (47%), Positives = 15/23 (65%) Frame = -2 Query: 595 ICSIYIDNYSHVDQRNCHRYEVS 527 I S N +VD+R+ HRYEV+ Sbjct: 462 ITSKLYGNSEYVDERHRHRYEVN 484 >gb|KHG10548.1| CTP synthase 1 [Gossypium arboreum] Length = 603 Score = 69.7 bits (169), Expect = 2e-09 Identities = 31/43 (72%), Positives = 36/43 (83%) Frame = -2 Query: 325 VNPK*TDKFEAADLKFVGRDESGKRMEIVELPSHPFYVGVQFH 197 VNP + EAA + FVGRDESG+RMEIVELPSHPF++GVQFH Sbjct: 483 VNPDMISELEAAGMSFVGRDESGRRMEIVELPSHPFFIGVQFH 525 >ref|NP_001238142.1| uncharacterized protein LOC100500185 [Glycine max] gi|255629601|gb|ACU15148.1| unknown [Glycine max] Length = 120 Score = 69.7 bits (169), Expect = 2e-09 Identities = 32/43 (74%), Positives = 35/43 (81%) Frame = -2 Query: 325 VNPK*TDKFEAADLKFVGRDESGKRMEIVELPSHPFYVGVQFH 197 VNP + E A LKFVG+DESGKRMEI+ELPSHPFYVG QFH Sbjct: 42 VNPDVIETLEEAGLKFVGKDESGKRMEILELPSHPFYVGAQFH 84 >gb|KJB81465.1| hypothetical protein B456_013G146900 [Gossypium raimondii] Length = 567 Score = 69.3 bits (168), Expect = 3e-09 Identities = 31/43 (72%), Positives = 36/43 (83%) Frame = -2 Query: 325 VNPK*TDKFEAADLKFVGRDESGKRMEIVELPSHPFYVGVQFH 197 VNP + EAA L FVGRDESG+RMEIVELPSHP+++GVQFH Sbjct: 448 VNPDMISQLEAAGLSFVGRDESGRRMEIVELPSHPYFIGVQFH 490 >ref|XP_012463837.1| PREDICTED: CTP synthase [Gossypium raimondii] gi|763814612|gb|KJB81464.1| hypothetical protein B456_013G146900 [Gossypium raimondii] Length = 602 Score = 69.3 bits (168), Expect = 3e-09 Identities = 31/43 (72%), Positives = 36/43 (83%) Frame = -2 Query: 325 VNPK*TDKFEAADLKFVGRDESGKRMEIVELPSHPFYVGVQFH 197 VNP + EAA L FVGRDESG+RMEIVELPSHP+++GVQFH Sbjct: 483 VNPDMISQLEAAGLSFVGRDESGRRMEIVELPSHPYFIGVQFH 525 >gb|KDO48490.1| hypothetical protein CISIN_1g008567mg [Citrus sinensis] Length = 561 Score = 69.3 bits (168), Expect = 3e-09 Identities = 32/43 (74%), Positives = 36/43 (83%) Frame = -2 Query: 325 VNPK*TDKFEAADLKFVGRDESGKRMEIVELPSHPFYVGVQFH 197 VNP+ E A LKFVG+DE+GKRMEI+ELPSHPFYVGVQFH Sbjct: 483 VNPEAIGVLEEAGLKFVGKDETGKRMEILELPSHPFYVGVQFH 525 Score = 54.7 bits (130), Expect(2) = 3e-06 Identities = 24/29 (82%), Positives = 27/29 (93%) Frame = -3 Query: 777 AQEHMGSTMRLGSRRTLFQTTDCITSKLY 691 ++ HMGSTMRLGSRRTLFQT DC+TSKLY Sbjct: 439 SRTHMGSTMRLGSRRTLFQTPDCVTSKLY 467 Score = 24.3 bits (51), Expect(2) = 3e-06 Identities = 9/16 (56%), Positives = 13/16 (81%) Frame = -2 Query: 574 NYSHVDQRNCHRYEVS 527 N +VD+R+ HRYEV+ Sbjct: 469 NAEYVDERHRHRYEVN 484