BLASTX nr result
ID: Papaver30_contig00028548
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver30_contig00028548 (535 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010682213.1| PREDICTED: OTU domain-containing protein DDB... 75 2e-11 ref|XP_011033701.1| PREDICTED: OTU domain-containing protein DDB... 74 6e-11 gb|KDO63485.1| hypothetical protein CISIN_1g027331mg [Citrus sin... 74 6e-11 gb|KDO63483.1| hypothetical protein CISIN_1g027331mg [Citrus sin... 74 6e-11 gb|KDO63482.1| hypothetical protein CISIN_1g027331mg [Citrus sin... 74 6e-11 ref|XP_006468944.1| PREDICTED: OTU domain-containing protein DDB... 74 6e-11 ref|XP_006446869.1| hypothetical protein CICLE_v10016580mg [Citr... 74 6e-11 ref|XP_002320400.2| OTU-like cysteine protease family protein [P... 74 6e-11 ref|XP_012067409.1| PREDICTED: OTU domain-containing protein DDB... 73 7e-11 ref|XP_012067407.1| PREDICTED: OTU domain-containing protein DDB... 73 7e-11 ref|XP_010028903.1| PREDICTED: OTU domain-containing protein DDB... 72 1e-10 ref|XP_010028901.1| PREDICTED: uncharacterized protein LOC104419... 72 1e-10 gb|KCW55734.1| hypothetical protein EUGRSUZ_I01566, partial [Euc... 72 1e-10 ref|XP_011468233.1| PREDICTED: OTU domain-containing protein DDB... 71 4e-10 ref|XP_009378070.1| PREDICTED: OTU domain-containing protein DDB... 71 4e-10 ref|XP_004304577.1| PREDICTED: OTU domain-containing protein DDB... 71 4e-10 ref|XP_007217756.1| hypothetical protein PRUPE_ppa011031mg [Prun... 71 4e-10 ref|XP_011623493.1| PREDICTED: OTU domain-containing protein DDB... 70 5e-10 ref|XP_010660641.1| PREDICTED: OTU domain-containing protein DDB... 70 5e-10 ref|XP_008231213.1| PREDICTED: OTU domain-containing protein DDB... 70 5e-10 >ref|XP_010682213.1| PREDICTED: OTU domain-containing protein DDB_G0284757 [Beta vulgaris subsp. vulgaris] gi|870856137|gb|KMT07825.1| hypothetical protein BVRB_6g146370 [Beta vulgaris subsp. vulgaris] Length = 225 Score = 75.1 bits (183), Expect = 2e-11 Identities = 32/34 (94%), Positives = 32/34 (94%) Frame = -2 Query: 534 ELWLSFWSEVHYNSLYELRNAPLPSKPRKKHWLF 433 ELWLSFWSEVHYNSLYELR APLP KPRKKHWLF Sbjct: 192 ELWLSFWSEVHYNSLYELRAAPLPPKPRKKHWLF 225 >ref|XP_011033701.1| PREDICTED: OTU domain-containing protein DDB_G0284757 [Populus euphratica] gi|743870884|ref|XP_011033702.1| PREDICTED: OTU domain-containing protein DDB_G0284757 [Populus euphratica] Length = 226 Score = 73.6 bits (179), Expect = 6e-11 Identities = 29/34 (85%), Positives = 33/34 (97%) Frame = -2 Query: 534 ELWLSFWSEVHYNSLYELRNAPLPSKPRKKHWLF 433 ELWLSFWSEVHYNSLYE+R+AP+P KP+KKHWLF Sbjct: 193 ELWLSFWSEVHYNSLYEIRDAPVPQKPKKKHWLF 226 >gb|KDO63485.1| hypothetical protein CISIN_1g027331mg [Citrus sinensis] gi|641844593|gb|KDO63486.1| hypothetical protein CISIN_1g027331mg [Citrus sinensis] Length = 121 Score = 73.6 bits (179), Expect = 6e-11 Identities = 29/34 (85%), Positives = 33/34 (97%) Frame = -2 Query: 534 ELWLSFWSEVHYNSLYELRNAPLPSKPRKKHWLF 433 ELWLSFWSEVHYNSLY++R+AP+P KPRKKHWLF Sbjct: 88 ELWLSFWSEVHYNSLYDIRDAPVPKKPRKKHWLF 121 >gb|KDO63483.1| hypothetical protein CISIN_1g027331mg [Citrus sinensis] gi|641844591|gb|KDO63484.1| hypothetical protein CISIN_1g027331mg [Citrus sinensis] Length = 160 Score = 73.6 bits (179), Expect = 6e-11 Identities = 29/34 (85%), Positives = 33/34 (97%) Frame = -2 Query: 534 ELWLSFWSEVHYNSLYELRNAPLPSKPRKKHWLF 433 ELWLSFWSEVHYNSLY++R+AP+P KPRKKHWLF Sbjct: 127 ELWLSFWSEVHYNSLYDIRDAPVPKKPRKKHWLF 160 >gb|KDO63482.1| hypothetical protein CISIN_1g027331mg [Citrus sinensis] Length = 225 Score = 73.6 bits (179), Expect = 6e-11 Identities = 29/34 (85%), Positives = 33/34 (97%) Frame = -2 Query: 534 ELWLSFWSEVHYNSLYELRNAPLPSKPRKKHWLF 433 ELWLSFWSEVHYNSLY++R+AP+P KPRKKHWLF Sbjct: 192 ELWLSFWSEVHYNSLYDIRDAPVPKKPRKKHWLF 225 >ref|XP_006468944.1| PREDICTED: OTU domain-containing protein DDB_G0284757-like isoform X1 [Citrus sinensis] gi|568829268|ref|XP_006468945.1| PREDICTED: OTU domain-containing protein DDB_G0284757-like isoform X2 [Citrus sinensis] Length = 225 Score = 73.6 bits (179), Expect = 6e-11 Identities = 29/34 (85%), Positives = 33/34 (97%) Frame = -2 Query: 534 ELWLSFWSEVHYNSLYELRNAPLPSKPRKKHWLF 433 ELWLSFWSEVHYNSLY++R+AP+P KPRKKHWLF Sbjct: 192 ELWLSFWSEVHYNSLYDIRDAPVPKKPRKKHWLF 225 >ref|XP_006446869.1| hypothetical protein CICLE_v10016580mg [Citrus clementina] gi|567909113|ref|XP_006446870.1| hypothetical protein CICLE_v10016580mg [Citrus clementina] gi|557549480|gb|ESR60109.1| hypothetical protein CICLE_v10016580mg [Citrus clementina] gi|557549481|gb|ESR60110.1| hypothetical protein CICLE_v10016580mg [Citrus clementina] Length = 225 Score = 73.6 bits (179), Expect = 6e-11 Identities = 29/34 (85%), Positives = 33/34 (97%) Frame = -2 Query: 534 ELWLSFWSEVHYNSLYELRNAPLPSKPRKKHWLF 433 ELWLSFWSEVHYNSLY++R+AP+P KPRKKHWLF Sbjct: 192 ELWLSFWSEVHYNSLYDIRDAPVPKKPRKKHWLF 225 >ref|XP_002320400.2| OTU-like cysteine protease family protein [Populus trichocarpa] gi|550324137|gb|EEE98715.2| OTU-like cysteine protease family protein [Populus trichocarpa] Length = 226 Score = 73.6 bits (179), Expect = 6e-11 Identities = 29/34 (85%), Positives = 33/34 (97%) Frame = -2 Query: 534 ELWLSFWSEVHYNSLYELRNAPLPSKPRKKHWLF 433 ELWLSFWSEVHYNSLYE+R+AP+P KP+KKHWLF Sbjct: 193 ELWLSFWSEVHYNSLYEIRDAPVPQKPKKKHWLF 226 >ref|XP_012067409.1| PREDICTED: OTU domain-containing protein DDB_G0284757 isoform X2 [Jatropha curcas] Length = 223 Score = 73.2 bits (178), Expect = 7e-11 Identities = 29/34 (85%), Positives = 33/34 (97%) Frame = -2 Query: 534 ELWLSFWSEVHYNSLYELRNAPLPSKPRKKHWLF 433 ELWLSFWSEVHYNSLYE+++AP+P KPRKKHWLF Sbjct: 190 ELWLSFWSEVHYNSLYEIQDAPIPHKPRKKHWLF 223 >ref|XP_012067407.1| PREDICTED: OTU domain-containing protein DDB_G0284757 isoform X1 [Jatropha curcas] gi|802564873|ref|XP_012067408.1| PREDICTED: OTU domain-containing protein DDB_G0284757 isoform X1 [Jatropha curcas] gi|643735252|gb|KDP41893.1| hypothetical protein JCGZ_26911 [Jatropha curcas] Length = 233 Score = 73.2 bits (178), Expect = 7e-11 Identities = 29/34 (85%), Positives = 33/34 (97%) Frame = -2 Query: 534 ELWLSFWSEVHYNSLYELRNAPLPSKPRKKHWLF 433 ELWLSFWSEVHYNSLYE+++AP+P KPRKKHWLF Sbjct: 200 ELWLSFWSEVHYNSLYEIQDAPIPHKPRKKHWLF 233 >ref|XP_010028903.1| PREDICTED: OTU domain-containing protein DDB_G0284757 isoform X2 [Eucalyptus grandis] Length = 229 Score = 72.4 bits (176), Expect = 1e-10 Identities = 28/34 (82%), Positives = 32/34 (94%) Frame = -2 Query: 534 ELWLSFWSEVHYNSLYELRNAPLPSKPRKKHWLF 433 E WLSFWSEVHYNSLYE+R+AP+P KP+KKHWLF Sbjct: 196 EFWLSFWSEVHYNSLYEIRDAPIPQKPKKKHWLF 229 >ref|XP_010028901.1| PREDICTED: uncharacterized protein LOC104419075 isoform X1 [Eucalyptus grandis] Length = 306 Score = 72.4 bits (176), Expect = 1e-10 Identities = 28/34 (82%), Positives = 32/34 (94%) Frame = -2 Query: 534 ELWLSFWSEVHYNSLYELRNAPLPSKPRKKHWLF 433 E WLSFWSEVHYNSLYE+R+AP+P KP+KKHWLF Sbjct: 273 EFWLSFWSEVHYNSLYEIRDAPIPQKPKKKHWLF 306 >gb|KCW55734.1| hypothetical protein EUGRSUZ_I01566, partial [Eucalyptus grandis] Length = 333 Score = 72.4 bits (176), Expect = 1e-10 Identities = 28/34 (82%), Positives = 32/34 (94%) Frame = -2 Query: 534 ELWLSFWSEVHYNSLYELRNAPLPSKPRKKHWLF 433 E WLSFWSEVHYNSLYE+R+AP+P KP+KKHWLF Sbjct: 300 EFWLSFWSEVHYNSLYEIRDAPIPQKPKKKHWLF 333 >ref|XP_011468233.1| PREDICTED: OTU domain-containing protein DDB_G0284757 isoform X2 [Fragaria vesca subsp. vesca] Length = 216 Score = 70.9 bits (172), Expect = 4e-10 Identities = 28/34 (82%), Positives = 32/34 (94%) Frame = -2 Query: 534 ELWLSFWSEVHYNSLYELRNAPLPSKPRKKHWLF 433 ELWLSFWSEVHYNSLYE+++AP+ KPRKKHWLF Sbjct: 183 ELWLSFWSEVHYNSLYEIKDAPIQQKPRKKHWLF 216 >ref|XP_009378070.1| PREDICTED: OTU domain-containing protein DDB_G0284757-like [Pyrus x bretschneideri] Length = 226 Score = 70.9 bits (172), Expect = 4e-10 Identities = 28/34 (82%), Positives = 32/34 (94%) Frame = -2 Query: 534 ELWLSFWSEVHYNSLYELRNAPLPSKPRKKHWLF 433 ELWLSFWSEVHYNSLYE+R+AP+ KPR+KHWLF Sbjct: 193 ELWLSFWSEVHYNSLYEIRDAPIQQKPRRKHWLF 226 >ref|XP_004304577.1| PREDICTED: OTU domain-containing protein DDB_G0284757 isoform X1 [Fragaria vesca subsp. vesca] gi|764618278|ref|XP_011468231.1| PREDICTED: OTU domain-containing protein DDB_G0284757 isoform X1 [Fragaria vesca subsp. vesca] gi|764618286|ref|XP_011468232.1| PREDICTED: OTU domain-containing protein DDB_G0284757 isoform X1 [Fragaria vesca subsp. vesca] Length = 226 Score = 70.9 bits (172), Expect = 4e-10 Identities = 28/34 (82%), Positives = 32/34 (94%) Frame = -2 Query: 534 ELWLSFWSEVHYNSLYELRNAPLPSKPRKKHWLF 433 ELWLSFWSEVHYNSLYE+++AP+ KPRKKHWLF Sbjct: 193 ELWLSFWSEVHYNSLYEIKDAPIQQKPRKKHWLF 226 >ref|XP_007217756.1| hypothetical protein PRUPE_ppa011031mg [Prunus persica] gi|595974225|ref|XP_007217757.1| hypothetical protein PRUPE_ppa011031mg [Prunus persica] gi|462413906|gb|EMJ18955.1| hypothetical protein PRUPE_ppa011031mg [Prunus persica] gi|462413907|gb|EMJ18956.1| hypothetical protein PRUPE_ppa011031mg [Prunus persica] Length = 226 Score = 70.9 bits (172), Expect = 4e-10 Identities = 28/34 (82%), Positives = 32/34 (94%) Frame = -2 Query: 534 ELWLSFWSEVHYNSLYELRNAPLPSKPRKKHWLF 433 ELWLSFWSEVHYNSLYE+R+AP+ KPR+KHWLF Sbjct: 193 ELWLSFWSEVHYNSLYEIRDAPIQQKPRRKHWLF 226 >ref|XP_011623493.1| PREDICTED: OTU domain-containing protein DDB_G0284757 [Amborella trichopoda] Length = 226 Score = 70.5 bits (171), Expect = 5e-10 Identities = 28/34 (82%), Positives = 32/34 (94%) Frame = -2 Query: 534 ELWLSFWSEVHYNSLYELRNAPLPSKPRKKHWLF 433 E WLSFWSEVHYNSLY+L++AP P+KPRKKHWLF Sbjct: 193 EFWLSFWSEVHYNSLYDLQDAPRPAKPRKKHWLF 226 >ref|XP_010660641.1| PREDICTED: OTU domain-containing protein DDB_G0284757 isoform X1 [Vitis vinifera] Length = 249 Score = 70.5 bits (171), Expect = 5e-10 Identities = 28/34 (82%), Positives = 32/34 (94%) Frame = -2 Query: 534 ELWLSFWSEVHYNSLYELRNAPLPSKPRKKHWLF 433 ELWLSFWSEVHYNSLYE+++AP+ KPRKKHWLF Sbjct: 216 ELWLSFWSEVHYNSLYEIKDAPIRQKPRKKHWLF 249 >ref|XP_008231213.1| PREDICTED: OTU domain-containing protein DDB_G0284757 [Prunus mume] Length = 228 Score = 70.5 bits (171), Expect = 5e-10 Identities = 28/34 (82%), Positives = 32/34 (94%) Frame = -2 Query: 534 ELWLSFWSEVHYNSLYELRNAPLPSKPRKKHWLF 433 ELWLSFWSEVHYNSLYE+R+AP+ KPR+KHWLF Sbjct: 195 ELWLSFWSEVHYNSLYEIRDAPVQQKPRRKHWLF 228